DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and ztf-23

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_491096.1 Gene:ztf-23 / 171880 WormBaseID:WBGene00021846 Length:419 Species:Caenorhabditis elegans


Alignment Length:228 Identity:68/228 - (29%)
Similarity:101/228 - (44%) Gaps:63/228 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QRDSDEEEP--------VDAKV-SKRRSRYQRKPPEEHKKRGPKPVPKMPHTCYECHKSFKCIAQ 161
            ||||.|:|.        .|.:. |.:..|:                     :|..|.::||..::
 Worm   220 QRDSPEQEDCSTSGVAFADGQTNSGKMGRF---------------------SCDRCSRTFKYQSK 263

  Fly   162 LTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERTHTGDKPFQCE-ICSKQFSALGNFQAHQKIH 225
            |.:|.|||.|.||:||.:|.::|:|:..||.|.|.|||::||.|: .|.|||::......|:|.|
 Worm   264 LDEHRRTHLGVKPFQCHYCTRQFSQRGALKTHMRLHTGERPFVCQWECGKQFASSSAKSHHEKTH 328

  Fly   226 LGVRDQVCSLCQKGFYTAGDLSKHMITHTGIKNHH-------------CDV--------CGKAFS 269
            .|.|..:|::|.|.|    ..:.|:|.|  :||.|             .||        .|.|.|
 Worm   329 SGERPYICNVCGKSF----TKNSHVIRH--LKNIHNRELAQQDAMLRGDDVQSTDESLNIGSARS 387

  Fly   270 RRRDMRTHKLKLHPLESSTNHDIVDDDDDEAID 302
            :..|     ::....|....||||:...:|..|
 Worm   388 QMSD-----IEPRGKEIGVVHDIVEQIHEERKD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 28/65 (43%)
C2H2 Zn finger 149..169 CDD:275368 7/19 (37%)
C2H2 Zn finger 177..197 CDD:275368 8/19 (42%)
zf-H2C2_2 189..213 CDD:404364 13/24 (54%)
C2H2 Zn finger 205..225 CDD:275368 7/20 (35%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
zf-H2C2_2 245..270 CDD:404364 10/45 (22%)
C2H2 Zn finger 261..282 CDD:275368 6/28 (21%)
C2H2 Zn finger 318..338 CDD:275368
ztf-23NP_491096.1 C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
zf-H2C2_2 264..288 CDD:290200 12/23 (52%)
C2H2 Zn finger 279..299 CDD:275368 8/19 (42%)
zf-H2C2_2 291..317 CDD:290200 14/25 (56%)
C2H2 Zn finger 307..328 CDD:275368 7/20 (35%)
zf-H2C2_2 324..344 CDD:290200 9/23 (39%)
C2H2 Zn finger 336..357 CDD:275368 9/26 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.