Sequence 1: | NP_609786.2 | Gene: | CG17328 / 34962 | FlyBaseID: | FBgn0028895 | Length: | 413 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011524789.1 | Gene: | ZNF524 / 147807 | HGNCID: | 28322 | Length: | 370 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 54/204 - (26%) |
---|---|---|---|
Similarity: | 85/204 - (41%) | Gaps: | 39/204 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 RQDAATNTDFVEKPLLPQR-----DSDEEEPV----------------------DAKVSKRRSRY 126
Fly 127 QRKPPEEHKKRGPKPVPKMPHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLK 191
Fly 192 VHERTHTGDKPFQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGI 256
Fly 257 KNHHCDVCG 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17328 | NP_609786.2 | zf-AD | 8..80 | CDD:214871 | |
COG5048 | 146..>211 | CDD:227381 | 22/64 (34%) | ||
C2H2 Zn finger | 149..169 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 177..197 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 189..213 | CDD:404364 | 8/23 (35%) | ||
C2H2 Zn finger | 205..225 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 233..253 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 245..270 | CDD:404364 | 5/21 (24%) | ||
C2H2 Zn finger | 261..282 | CDD:275368 | 1/5 (20%) | ||
C2H2 Zn finger | 318..338 | CDD:275368 | |||
ZNF524 | XP_011524789.1 | COG5048 | <219..>283 | CDD:227381 | 22/63 (35%) |
C2H2 Zn finger | 222..242 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 234..259 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 250..270 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 262..285 | CDD:290200 | 8/22 (36%) | ||
C2H2 Zn finger | 278..298 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 290..314 | CDD:290200 | 6/23 (26%) | ||
C2H2 Zn finger | 306..327 | CDD:275368 | 7/26 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |