DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and ZNF524

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_011524789.1 Gene:ZNF524 / 147807 HGNCID:28322 Length:370 Species:Homo sapiens


Alignment Length:204 Identity:54/204 - (26%)
Similarity:85/204 - (41%) Gaps:39/204 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 RQDAATNTDFVEKPLLPQR-----DSDEEEPV----------------------DAKVSKRRSRY 126
            |...||:::...|..||::     .|.:|.|:                      |..|....|..
Human   141 RPGGATSSNRTLKASLPRKRGRPPKSGQEPPLVQVQGVTAPVGSSGGSDLLLIDDQGVPYTVSEG 205

  Fly   127 QRKPPEEHKKRGPKPVPKMPHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLK 191
            ....||   ..||:   |.||.|..|.::|..::.|.:|..:|:..||:||..|.:.|.:..:|:
Human   206 SAAGPE---GSGPR---KAPHFCPVCLRAFPYLSDLERHSISHSELKPHQCKVCGKTFKRSSHLR 264

  Fly   192 VHERTHTGDKPFQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGI 256
            .|...|.|.:||:|.:|.::|...|....|.::|.|.|...|.:|:..|..|..|.:|      .
Human   265 RHCNIHAGLRPFRCPLCPRRFREAGELAHHHRVHSGERPYQCPICRLRFTEANTLRRH------A 323

  Fly   257 KNHHCDVCG 265
            |..|.:..|
Human   324 KRKHPEAMG 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 22/64 (34%)
C2H2 Zn finger 149..169 CDD:275368 5/19 (26%)
C2H2 Zn finger 177..197 CDD:275368 5/19 (26%)
zf-H2C2_2 189..213 CDD:404364 8/23 (35%)
C2H2 Zn finger 205..225 CDD:275368 5/19 (26%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
zf-H2C2_2 245..270 CDD:404364 5/21 (24%)
C2H2 Zn finger 261..282 CDD:275368 1/5 (20%)
C2H2 Zn finger 318..338 CDD:275368
ZNF524XP_011524789.1 COG5048 <219..>283 CDD:227381 22/63 (35%)
C2H2 Zn finger 222..242 CDD:275368 5/19 (26%)
zf-H2C2_2 234..259 CDD:290200 9/24 (38%)
C2H2 Zn finger 250..270 CDD:275368 5/19 (26%)
zf-H2C2_2 262..285 CDD:290200 8/22 (36%)
C2H2 Zn finger 278..298 CDD:275368 5/19 (26%)
zf-H2C2_2 290..314 CDD:290200 6/23 (26%)
C2H2 Zn finger 306..327 CDD:275368 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.