DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and znf770

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_005160468.1 Gene:znf770 / 100535231 ZFINID:ZDB-GENE-030131-1505 Length:1207 Species:Danio rerio


Alignment Length:334 Identity:75/334 - (22%)
Similarity:129/334 - (38%) Gaps:100/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 DAATNTDFVEK----------------PLL-PQRDSDEEEPVDAKVSKRRSRYQRKPPEEHKKRG 138
            |.:.|...|:|                ||: ...|:.:||.::.:::.....|.           
Zfish   375 DVSQNLSTVDKQHLEMLQCDNHLNQNAPLINSSADTLKEEVIEEQIADANPTYF----------- 428

  Fly   139 PKPVPKMPHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERTH------ 197
             |...|..:.|..|.|.|...::|::|:..||.:||::||.|.:.|...|:|:.|::.|      
Zfish   429 -KHTSKNVNQCKICLKKFSYPSRLSRHLLVHTDDKPFKCSECSKSFRNPYHLRRHQKIHKREKKY 492

  Fly   198 ----TG-----------------DKPFQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFY 241
                ||                 |..:||::|.|.||.....:.||.:|.|.:...|.:|:|.|.
Zfish   493 IANKTGHQLLYSSNVTSTSLLKTDSGYQCDVCLKTFSVPSKLRRHQIVHSGTKPYTCMICRKSFS 557

  Fly   242 TAGDLSKHMITHTG---------------------IKNHHC--------------DVCGKAFSRR 271
            .|..|:||:..|||                     ::.::|              .|.|:...:.
Zfish   558 QAYSLTKHIKLHTGKVNSPSLLHWLRGSKSSITGALQTNNCGPNDANASLPKELDSVDGQTNEKL 622

  Fly   272 RDMRTHKLKLHPLESST-----NHDIVDDDDDEAIDTDPVGLDTLDHAH--FKCPDCDKAFDTAD 329
            :|.......:...|||.     :.|::.|.::...::.|.  ::||.::  .:|..|.|.|....
Zfish   623 QDHSQLDQNVSLTESSNTVKTESEDVLKDSEEPTANSSPT--NSLDKSNDENQCVICLKTFPYPS 685

  Fly   330 SLSLHFRTH 338
            .||.|..||
Zfish   686 KLSRHLLTH 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 24/91 (26%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
C2H2 Zn finger 177..197 CDD:275368 7/19 (37%)
zf-H2C2_2 189..213 CDD:404364 10/50 (20%)
C2H2 Zn finger 205..225 CDD:275368 7/19 (37%)
C2H2 Zn finger 233..253 CDD:275368 8/19 (42%)
zf-H2C2_2 245..270 CDD:404364 9/59 (15%)
C2H2 Zn finger 261..282 CDD:275368 4/34 (12%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
znf770XP_005160468.1 C2H2 Zn finger 75..95 CDD:275368
C2H2 Zn finger 103..123 CDD:275368
C2H2 Zn finger 189..209 CDD:275368
zf-H2C2_2 202..225 CDD:290200
C2H2 Zn finger 217..257 CDD:275368
C2H2 Zn finger 288..308 CDD:275368
C2H2 Zn finger 316..336 CDD:275368
C2H2 Zn finger 438..458 CDD:275368 6/19 (32%)
zf-C2H2 464..486 CDD:278523 7/21 (33%)
C2H2 Zn finger 466..486 CDD:275368 7/19 (37%)
COG5048 497..902 CDD:227381 45/200 (23%)
C2H2 Zn finger 521..541 CDD:275368 7/19 (37%)
zf-H2C2_2 534..558 CDD:290200 8/23 (35%)
C2H2 Zn finger 549..569 CDD:275368 8/19 (42%)
C2H2 Zn finger 674..694 CDD:275368 7/19 (37%)
C2H2 Zn finger 702..722 CDD:275368
C2H2 Zn finger 740..760 CDD:275368
C2H2 Zn finger 768..788 CDD:275368
C2H2 Zn finger 855..875 CDD:275368
C2H2 Zn finger 883..903 CDD:275368
C2H2 Zn finger 1115..1135 CDD:275368
C2H2 Zn finger 1148..1168 CDD:275368
zf-H2C2_2 1161..1185 CDD:290200
C2H2 Zn finger 1176..1196 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.