DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17329 and AT5G37280

DIOPT Version :9

Sequence 1:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_198544.1 Gene:AT5G37280 / 833702 AraportID:AT5G37280 Length:216 Species:Arabidopsis thaliana


Alignment Length:70 Identity:25/70 - (35%)
Similarity:34/70 - (48%) Gaps:16/70 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 QRL--DRMVENS-----TCSICLLPWTD-------NGIHRLVSLRCGHLFGSSCIHMAIRRNHRC 139
            |||  ::.||.|     :||||....:|       |.|.::.  :|.|.|...||...|.|.:.|
plant   141 QRLLEEQTVEPSMDSDESCSICFEKLSDSLSETYHNSIIQMP--KCLHSFHQKCIFKWIGRQNSC 203

  Fly   140 PICRR 144
            |:|||
plant   204 PLCRR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17329NP_609784.2 zf-RING_2 99..143 CDD:290367 16/50 (32%)
AT5G37280NP_198544.1 COG5540 <107..207 CDD:227827 22/67 (33%)
RING_Ubox 158..207 CDD:388418 16/50 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2695
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.