DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17329 and AT5G37280

DIOPT Version :10

Sequence 1:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_198544.1 Gene:AT5G37280 / 833702 AraportID:AT5G37280 Length:216 Species:Arabidopsis thaliana


Alignment Length:70 Identity:25/70 - (35%)
Similarity:34/70 - (48%) Gaps:16/70 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 QRL--DRMVENS-----TCSICLLPWTD-------NGIHRLVSLRCGHLFGSSCIHMAIRRNHRC 139
            |||  ::.||.|     :||||....:|       |.|.::.  :|.|.|...||...|.|.:.|
plant   141 QRLLEEQTVEPSMDSDESCSICFEKLSDSLSETYHNSIIQMP--KCLHSFHQKCIFKWIGRQNSC 203

  Fly   140 PICRR 144
            |:|||
plant   204 PLCRR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17329NP_609784.2 HRD1 <36..>144 CDD:227568 23/68 (34%)
RING_Ubox 96..155 CDD:473075 21/61 (34%)
AT5G37280NP_198544.1 COG5540 <107..207 CDD:227827 22/67 (33%)
zf-RING_2 158..207 CDD:433370 16/50 (32%)

Return to query results.
Submit another query.