DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17329 and AT5G37270

DIOPT Version :10

Sequence 1:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_198543.1 Gene:AT5G37270 / 833701 AraportID:AT5G37270 Length:208 Species:Arabidopsis thaliana


Alignment Length:50 Identity:21/50 - (42%)
Similarity:31/50 - (62%) Gaps:1/50 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 ENSTCSICLLPWTDNGIHRLVSL-RCGHLFGSSCIHMAIRRNHRCPICRR 144
            |.:||||||..::::....::.| .|.|||..|||...::|...||:|||
plant   149 EETTCSICLEDFSESHDDNIILLPDCFHLFHQSCIFEWLKRQRSCPLCRR 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17329NP_609784.2 HRD1 <36..>144 CDD:227568 19/48 (40%)
RING_Ubox 96..155 CDD:473075 20/49 (41%)
AT5G37270NP_198543.1 RING-H2_PA-TM-RING 152..197 CDD:438118 17/44 (39%)

Return to query results.
Submit another query.