powered by:
Protein Alignment CG17329 and AT5G37270
DIOPT Version :9
Sequence 1: | NP_609784.2 |
Gene: | CG17329 / 34958 |
FlyBaseID: | FBgn0028896 |
Length: | 162 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_198543.1 |
Gene: | AT5G37270 / 833701 |
AraportID: | AT5G37270 |
Length: | 208 |
Species: | Arabidopsis thaliana |
Alignment Length: | 50 |
Identity: | 21/50 - (42%) |
Similarity: | 31/50 - (62%) |
Gaps: | 1/50 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 96 ENSTCSICLLPWTDNGIHRLVSL-RCGHLFGSSCIHMAIRRNHRCPICRR 144
|.:||||||..::::....::.| .|.|||..|||...::|...||:|||
plant 149 EETTCSICLEDFSESHDDNIILLPDCFHLFHQSCIFEWLKRQRSCPLCRR 198
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
42 |
1.000 |
Inparanoid score |
I2695 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.960 |
|
Return to query results.
Submit another query.