powered by:
Protein Alignment CG17329 and AT5G37250
DIOPT Version :9
Sequence 1: | NP_609784.2 |
Gene: | CG17329 / 34958 |
FlyBaseID: | FBgn0028896 |
Length: | 162 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001330830.1 |
Gene: | AT5G37250 / 833699 |
AraportID: | AT5G37250 |
Length: | 208 |
Species: | Arabidopsis thaliana |
Alignment Length: | 50 |
Identity: | 20/50 - (40%) |
Similarity: | 31/50 - (62%) |
Gaps: | 1/50 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 96 ENSTCSICLLPWTDNGIHRLVSL-RCGHLFGSSCIHMAIRRNHRCPICRR 144
|.:||||||..::::....::.| .|.|||..:||...::|...||:|||
plant 149 EETTCSICLEDFSESHDDNIILLPDCFHLFHQNCIFEWLKRQRSCPLCRR 198
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17329 | NP_609784.2 |
zf-RING_2 |
99..143 |
CDD:290367 |
16/44 (36%) |
AT5G37250 | NP_001330830.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
42 |
1.000 |
Inparanoid score |
I2695 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.050 |
|
Return to query results.
Submit another query.