DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17329 and AT3G28620

DIOPT Version :10

Sequence 1:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_189503.1 Gene:AT3G28620 / 822492 AraportID:AT3G28620 Length:211 Species:Arabidopsis thaliana


Alignment Length:139 Identity:33/139 - (23%)
Similarity:53/139 - (38%) Gaps:34/139 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LRDHNLR-------VKHLNTQRRRILRLLQGKMLQYATLEERLHRIGELVLI--AELHSGVKTLN 88
            |.||:|.       |:....|:|:...|.|.:.|......:..|::..:|..  |.|.:.....:
plant    85 LHDHDLSEQLSYKIVQAQQRQKRQSFYLPQQRPLFMIVSVKLTHKVYNVVSCDSAPLATDFDQES 149

  Fly    89 QRLDRMVENSTCSICL-----------LPWTDNGIHRLVSLRCGHLFGSSCI-HMAIRRNHRCPI 141
            |: :...|:.||:|||           :|            .|.|.|...|: ....|.|:.||:
plant   150 QQ-EEEEESKTCAICLENLLRSEDYCEMP------------TCSHYFHEPCLTEWLTRDNNSCPL 201

  Fly   142 CRRRARHFH 150
            ||:.....|
plant   202 CRKPVDKLH 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17329NP_609784.2 HRD1 <36..>144 CDD:227568 29/128 (23%)
RING_Ubox 96..155 CDD:473075 18/67 (27%)
AT3G28620NP_189503.1 RING_Ubox 159..206 CDD:473075 16/58 (28%)

Return to query results.
Submit another query.