powered by:
Protein Alignment CG17329 and rnf4
DIOPT Version :9
Sequence 1: | NP_609784.2 |
Gene: | CG17329 / 34958 |
FlyBaseID: | FBgn0028896 |
Length: | 162 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001373177.1 |
Gene: | rnf4 / 557319 |
ZFINID: | ZDB-GENE-041008-246 |
Length: | 184 |
Species: | Danio rerio |
Alignment Length: | 60 |
Identity: | 23/60 - (38%) |
Similarity: | 35/60 - (58%) |
Gaps: | 4/60 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 TCSICLLPWT---DNGIHRLVSLRCGHLFGSSCIHMAIRRNHRCPICRRRARHFHVRRIY 155
:|.:|:..:: |:| ..:||.:|||||.|.||..::.|.|.||.||::..|.....||
Zfish 125 SCPVCMDVYSEIMDSG-RLMVSTKCGHLFCSQCIRDSLSRAHSCPTCRKKLTHKQYHPIY 183
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001208 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.