DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17329 and RFWD3

DIOPT Version :10

Sequence 1:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_060594.3 Gene:RFWD3 / 55159 HGNCID:25539 Length:774 Species:Homo sapiens


Alignment Length:110 Identity:40/110 - (36%)
Similarity:59/110 - (53%) Gaps:21/110 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LEERLHRIG---ELVLIAELHSGVKTL-----NQRLDRMV--------ENSTCSICLLPWTDNGI 112
            |||:|..:.   |:..|    .|.|||     .|:.:.::        |..||:|||..||:.|.
Human   239 LEEQLAGVSAEQEVTCI----DGGKTLPKQPSPQKSEPLLPSASMDEEEGDTCTICLEQWTNAGD 299

  Fly   113 HRLVSLRCGHLFGSSCIHMAIR-RNHRCPICRRRARHFHVRRIYS 156
            |||.:||||||||..||...:: :..:||.|.::|||..:..:|:
Human   300 HRLSALRCGHLFGYRCISTWLKGQVRKCPQCNKKARHSDIVVLYA 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17329NP_609784.2 HRD1 <36..>144 CDD:227568 36/96 (38%)
RING_Ubox 96..155 CDD:473075 28/59 (47%)
RFWD3NP_060594.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..116
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..225
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..280 5/22 (23%)
mRING-C3HGC3_RFWD3 283..343 CDD:438114 28/59 (47%)
WD 1 495..537
WD40 496..762 CDD:475233
WD40 repeat 500..537 CDD:293791
WD 2 539..577
WD40 repeat 543..580 CDD:293791
WD 3 583..628
WD40 repeat 588..655 CDD:293791
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.