DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17329 and dgrn

DIOPT Version :9

Sequence 1:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_649596.1 Gene:dgrn / 40725 FlyBaseID:FBgn0037384 Length:319 Species:Drosophila melanogaster


Alignment Length:114 Identity:39/114 - (34%)
Similarity:56/114 - (49%) Gaps:14/114 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RRRILRLLQGKMLQYATLEERLHRIGELVLIAELHSGVKTLNQRLD--RMVENSTCSICLLPWTD 109
            |.|.:.|.....|   |:..|.....:.|:..::.|..|.:|:.:|  :..|...|.||:    |
  Fly   214 RSRTVNLHSNDSL---TILPRRSAENDPVVDLDVASPPKRVNRDIDESQKEELYKCPICM----D 271

  Fly   110 NGIHR-LVSLRCGHLFGSSCIHMAIRRNHRCPICRRR--ARHFHVRRIY 155
            :...| .||.:|||:|...||..|||..|:||||.::  ||.|.  |||
  Fly   272 SVSKREPVSTKCGHVFCRECIETAIRATHKCPICNKKLTARQFF--RIY 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17329NP_609784.2 zf-RING_2 99..143 CDD:290367 20/44 (45%)
dgrnNP_649596.1 RING 266..305 CDD:214546 19/42 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.