DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17329 and CG13481

DIOPT Version :9

Sequence 1:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001097605.1 Gene:CG13481 / 39579 FlyBaseID:FBgn0036421 Length:176 Species:Drosophila melanogaster


Alignment Length:149 Identity:71/149 - (47%)
Similarity:96/149 - (64%) Gaps:18/149 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SNGNLEEQVRKLRDHNLRVKHLNTQRRRILRLLQGKMLQYATLE--------ERLHRIGELVLIA 78
            |:.::||:||::...|..:|..|::|.|||..||..:....::|        |.|:         
  Fly    38 SDVSIEERVRRMEVLNNNMKWFNSERTRILEQLQLNIFGQISVEHHNAMNMSENLY--------- 93

  Fly    79 ELHSGVKTLNQRLDRMVENSTCSICLLPWTDNGIHRLVSLRCGHLFGSSCIHMAIRRNHRCPICR 143
            ||..|:..|::|::.|.|:.||||||.||:.||.||:||||||||||:|||..||||:|||||||
  Fly    94 ELREGLDGLSRRMESMQEDITCSICLSPWSSNGRHRVVSLRCGHLFGNSCIRTAIRRSHRCPICR 158

  Fly   144 RRARHFHVRRIYSPSFLSH 162
            |||.|..||||:|.. :||
  Fly   159 RRALHADVRRIFSRR-ISH 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17329NP_609784.2 zf-RING_2 99..143 CDD:290367 34/43 (79%)
CG13481NP_001097605.1 zf-RING_2 114..158 CDD:290367 34/43 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447438
Domainoid 1 1.000 54 1.000 Domainoid score I4143
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2695
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.