DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17329 and rfp2

DIOPT Version :9

Sequence 1:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_593439.1 Gene:rfp2 / 2543192 PomBaseID:SPAC343.18 Length:205 Species:Schizosaccharomyces pombe


Alignment Length:150 Identity:31/150 - (20%)
Similarity:54/150 - (36%) Gaps:31/150 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PTEPSNGNLEEQVRKLRDHNLRVKHLNTQRRRILRLLQGKMLQYATLEERLHRIGELV-----LI 77
            |.....|.:....|:.|:.:      .||||.:|.  .|........::..:.|.|.|     ..
pombe    80 PPVAVGGGIFYGARRTRNRS------QTQRRTLLE--NGFRNSRKKAQDSSNSIAERVSPPPGFC 136

  Fly    78 AELHSGVKTLNQRLDRMVENSTCSICLLPWTDNGIHRLVSLRCGHLFGSSCIHMAIRRNHRCPI- 141
            .::|..            .|..|:.|......:....:.:.:|||||.|:|.....::...||: 
pombe   137 YDVHPH------------NNIACAKCGNELVSDEKKSIFAAKCGHLFCSTCAKELRKKTVPCPVQ 189

  Fly   142 -CRRRARHFHVRRIYSPSFL 160
             ||:|.    .::...|.:|
pombe   190 HCRKRI----TKKFIFPLYL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17329NP_609784.2 zf-RING_2 99..143 CDD:290367 11/45 (24%)
rfp2NP_593439.1 zf-RING_5 147..193 CDD:291308 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.