DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17329 and rfp1

DIOPT Version :10

Sequence 1:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_593782.1 Gene:rfp1 / 2542542 PomBaseID:SPAC19A8.10 Length:254 Species:Schizosaccharomyces pombe


Alignment Length:63 Identity:15/63 - (23%)
Similarity:25/63 - (39%) Gaps:11/63 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RMVENSTCSICLLPWTDNGIHR------LVSLRCGHLFGSSC---IHMAIRRNHRCPI--CRR 144
            |...|.|..:|.......|..:      |.:.:|||::..||   :..:.|...:|.:  |.|
pombe   179 RSFNNDTLMVCPRCQEPLGTSKSKEKSALWATKCGHVYCGSCAKVLKTSKRSQSKCLVNDCGR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17329NP_609784.2 HRD1 <36..>144 CDD:227568 14/61 (23%)
RING_Ubox 96..155 CDD:473075 14/60 (23%)
rfp1NP_593782.1 RING_Ubox 187..>234 CDD:473075 9/46 (20%)

Return to query results.
Submit another query.