DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17329 and Rfwd3

DIOPT Version :9

Sequence 1:	NP_609784.2	Gene:	CG17329 / 34958	FlyBaseID:	FBgn0028896	Length:	162	Species:	Drosophila melanogaster
Sequence 2:	NP_666330.2	Gene:	Rfwd3 / 234736	MGIID:	2384584	Length:	774	Species:	Mus musculus

Alignment Length:	64	Identity:	29/64 - (45%)
Similarity:	42/64 - (65%)	Gaps:	1/64 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    96 ENSTCSICLLPWTDNGIHRLVSLRCGHLFGSSCIHMAIR-RNHRCPICRRRARHFHVRRIYSPS 158
            |..||:|||..||:.|.||:.:||||||||..||...:: :..:||.|.::|:|..:..||:.|
Mouse   284 EGETCTICLEQWTNAGDHRISALRCGHLFGFRCISKWLKGQTRKCPQCNKKAKHSDIVVIYARS 347

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17329	NP_609784.2	zf-RING_2	99..143	CDD:290367	22/44 (50%)
Rfwd3	NP_666330.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	32..126
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	203..281
		RING	287..334	CDD:238093	23/46 (50%)
		WD40	451..>571	CDD:295369
		WD40	<486..>626	CDD:225201
		WD 1	493..535
		WD40 repeat	501..537	CDD:293791
		WD 2	536..568
		WD40 repeat	542..582	CDD:293791
		WD 3	583..628
		WD40 repeat	590..644	CDD:293791
		WD40 repeat	701..741	CDD:293791
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167836267
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S7722
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R5303
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	5	4.820