DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17329 and Rnf4

DIOPT Version :9

Sequence 1:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001291198.1 Gene:Rnf4 / 19822 MGIID:1201691 Length:194 Species:Mus musculus


Alignment Length:176 Identity:41/176 - (23%)
Similarity:70/176 - (39%) Gaps:31/176 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTEQQQQEPTEPSNGNLE----EQVRKLRD------------------HNLRVKHLNTQRR---- 48
            :|:::.:|.|.....:||    |.|..:.|                  ||..|..:..:||    
Mouse    19 QTQKRTRETTSTPEVSLETEPIELVETVGDEIVDLTCESLEPVVVDLTHNDSVVIVEERRRPRRN 83

  Fly    49 -RILRLLQGKMLQYATLEERLHRIGELVLIAELHSGVKTLNQRLDRMVENSTCSICLLPWTD--- 109
             |.||.........::.:|.|.|..::.:........|.......|.....:|.||:..:::   
Mouse    84 GRRLRQDHADSCVVSSDDEELSRDKDVYVTTHTPRSTKDDGATGPRPSGTVSCPICMDGYSEIVQ 148

  Fly   110 NGIHRLVSLRCGHLFGSSCIHMAIRRNHRCPICRRRARHFHVRRIY 155
            || ..:||..|||:|.|.|:..:::..:.||.||::..|.....||
Mouse   149 NG-RLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIY 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG17329NP_609784.2 zf-RING_2 99..143 CDD:290367 15/46 (33%)
Rnf4NP_001291198.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 5/19 (26%)