DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17329 and CG43058

DIOPT Version :10

Sequence 1:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001246302.1 Gene:CG43058 / 12798445 FlyBaseID:FBgn0262360 Length:100 Species:Drosophila melanogaster


Alignment Length:73 Identity:23/73 - (31%)
Similarity:34/73 - (46%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VKTLNQRLDRMVENSTCSICLLPWTDNGIHRL-VSLRCGHLFGSSCIHMAIRRNHRCPICRRRAR 147
            ||.|...|....|...|.||:    :|...|. .:..|||:|...||..||....:||:|.::..
  Fly    31 VKRLRSDLGDSDEPYMCPICM----ENVRRRQPAATPCGHVFCYDCIQKAIGDYKKCPMCNKKIM 91

  Fly   148 HFHVRRIY 155
            :..:.||:
  Fly    92 YKQLTRIF 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17329NP_609784.2 HRD1 <36..>144 CDD:227568 21/60 (35%)
RING_Ubox 96..155 CDD:473075 18/59 (31%)
CG43058NP_001246302.1 RING_Ubox 47..99 CDD:473075 17/55 (31%)

Return to query results.
Submit another query.