DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17329 and Rfwd3

DIOPT Version :9

Sequence 1:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster
Sequence 2:XP_341691.8 Gene:Rfwd3 / 103690025 RGDID:1305243 Length:765 Species:Rattus norvegicus


Alignment Length:64 Identity:29/64 - (45%)
Similarity:41/64 - (64%) Gaps:1/64 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 ENSTCSICLLPWTDNGIHRLVSLRCGHLFGSSCIHMAIR-RNHRCPICRRRARHFHVRRIYSPS 158
            |..||:|||..||..|.|||.:||||||||..||...:: :..:||.|.::|:|..:..:|:.|
  Rat   275 EGETCTICLEQWTSAGDHRLSALRCGHLFGYRCIFKWLKGQTRKCPQCNKKAKHSDIVVLYARS 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17329NP_609784.2 zf-RING_2 99..143 CDD:290367 23/44 (52%)
Rfwd3XP_341691.8 mRING-C3HGC3_RFWD3 275..323 CDD:319364 24/47 (51%)
WD40 <470..>624 CDD:225201
WD40 repeat 491..528 CDD:293791
WD40 repeat 534..572 CDD:293791
WD40 repeat 579..617 CDD:293791
WD40 repeat 692..731 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.