powered by:
Protein Alignment CG17329 and Rfwd3
DIOPT Version :9
Sequence 1: | NP_609784.2 |
Gene: | CG17329 / 34958 |
FlyBaseID: | FBgn0028896 |
Length: | 162 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_341691.8 |
Gene: | Rfwd3 / 103690025 |
RGDID: | 1305243 |
Length: | 765 |
Species: | Rattus norvegicus |
Alignment Length: | 64 |
Identity: | 29/64 - (45%) |
Similarity: | 41/64 - (64%) |
Gaps: | 1/64 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 96 ENSTCSICLLPWTDNGIHRLVSLRCGHLFGSSCIHMAIR-RNHRCPICRRRARHFHVRRIYSPS 158
|..||:|||..||..|.|||.:||||||||..||...:: :..:||.|.::|:|..:..:|:.|
Rat 275 EGETCTICLEQWTSAGDHRLSALRCGHLFGYRCIFKWLKGQTRKCPQCNKKAKHSDIVVLYARS 338
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1451258at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.