DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pkaap and RAX1

DIOPT Version :9

Sequence 1:NP_609783.1 Gene:pkaap / 34957 FlyBaseID:FBgn0040079 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_014945.3 Gene:RAX1 / 854477 SGDID:S000005827 Length:435 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:47/233 - (20%)
Similarity:85/233 - (36%) Gaps:54/233 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 DIFTYNSRLSMNLASIVNDPNCLSYFVQYLDTRQALPLIKFYLDIE-----NFKRA--------- 151
            |::|:.:.||       ..|..::|...::|......|.|.|:::.     ||.:.         
Yeast    38 DLWTFYTFLS-------QFPYAINYLDFWVDLMTHTRLCKNYIELVRKSLINFPQEQQQNGSTST 95

  Fly   152 -------ALTQEKEEPEEPPRKAIEQSSPHKDDKDVPELKTLCDL---------SMRKPLTDDEK 200
                   ||.:|.....|.|.|.:|.|.|     |||....|.:|         ..::.|.:::.
Yeast    96 ATFDLLNALIEEGHLDPEAPDKLLENSGP-----DVPFSPKLNELLGDWKHQSGIGQEALRNEDV 155

  Fly   201 SRIYAETNKQLNRQKSGTDSVLNAELSRASISDAIAIYQKYLIVNASLQVELPIVILAHISLLLC 265
            :.|..|..|: ..|:.|...:...:|    :..|:.:...||:     ..|.....|::|.:...
Yeast   156 ALIVDEIMKR-RSQQDGKPQITTKQL----LHSAVGLCNTYLV-----SPEQSERYLSNIPMETR 210

  Fly   266 GR--DKSECSKPIPASCFDEAREFVLEQLERDHVQGFL 301
            .|  :..:..:......||:.:....:.||.|....||
Yeast   211 NRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKFL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkaapNP_609783.1 RGS 109..308 CDD:295367 45/225 (20%)
RGS_AKAP2_2 324..444 CDD:188676
AKAP10_AKB 561..605 CDD:214003
RAX1NP_014945.3 RGS <189..255 CDD:214613 13/65 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13155
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.