DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pkaap and SPAC23G3.05c

DIOPT Version :9

Sequence 1:NP_609783.1 Gene:pkaap / 34957 FlyBaseID:FBgn0040079 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_593105.1 Gene:SPAC23G3.05c / 2541778 PomBaseID:SPAC23G3.05c Length:343 Species:Schizosaccharomyces pombe


Alignment Length:144 Identity:30/144 - (20%)
Similarity:58/144 - (40%) Gaps:29/144 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 LERDHVQGFLQSGYYSTYCLELIEGGSVNIYDVLNSELALFYFTEYLEQRQERECLE--FWITAI 354
            |.|:|::|..::|..||         |:|...  :|.|...:||.:.......|.|.  :|   .
pombe    50 LFREHIRGLYKAGVTST---------SLNTES--SSTLGPHHFTRFRSASLSLEDLSTVYW---P 100

  Fly   355 NFRKSFACGEEKEEDRKAAQSDAMIIYDKYFSLQSECRLWMSQKLRLRVEQAICAPNEQWQAFDL 419
            ||.....  ||...::....||.::..|:...|::    .::..::...:::.....||.:.|..
pombe   101 NFGPLLL--EELSNEQTINSSDLLLSKDRAAYLKN----LLTSNIQSLTQESTVISKEQVKMFTQ 159

  Fly   420 ALLVTAKYLEQKYF 433
            .::       :|||
pombe   160 III-------EKYF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkaapNP_609783.1 RGS 109..308 CDD:295367 5/15 (33%)
RGS_AKAP2_2 324..444 CDD:188676 21/112 (19%)
AKAP10_AKB 561..605 CDD:214003
SPAC23G3.05cNP_593105.1 RGS <146..224 CDD:295367 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13155
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.