DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crp and BHLH101

DIOPT Version :9

Sequence 1:NP_001285976.1 Gene:crp / 34956 FlyBaseID:FBgn0001994 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_196035.2 Gene:BHLH101 / 830293 AraportID:AT5G04150 Length:260 Species:Arabidopsis thaliana


Alignment Length:248 Identity:53/248 - (21%)
Similarity:96/248 - (38%) Gaps:61/248 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LEDSGGENYHIEFASESAHQGSQRRQSSMSGTNTSKGGGGGGSGALSDGDGSGKPLVDSEKRMRR 98
            |:||...|.::.      |.......::.|..|..:....|.              |..||::..
plant    46 LDDSKSHNINLH------HMSLSHSNNTNSNNNNYQEEDRGA--------------VVLEKKLNH 90

  Fly    99 EIANSNERRRMQSINAGFQSLRSLLP-RHEGEKLSKAAILQQTFQYIVELENQKTQLLTQNSELK 162
               |::||.|.:.:||.:.|||:||| ..:..|||....:.:..:||.|.:.:..:|..:..||.
plant    91 ---NASERDRRRKLNALYSSLRALLPLSDQKRKLSIPMTVARVVKYIPEQKQELQRLSRRKEELL 152

  Fly   163 RQVGEHEAGGSGDGGGTNSGGNYNDSNA-SGGNSTAVAIKKRKLTDNVINIQ-------AISDS- 218
            :::...          |:.....|.:.. |..:|::..|....|||..|.:|       ::||. 
plant   153 KRISRK----------THQEQLRNKAMMDSIDSSSSQRIAANWLTDTEIAVQIATSKWTSVSDML 207

  Fly   219 ---SDEGLGSMSPEPMTLLTAGGAAATKLSNAATLLAAKELH---ESKKQLEK 265
               .:.||..:|            .::.:|:.|.:.....|.   :.|.:||:
plant   208 LRLEENGLNVIS------------VSSSVSSTARIFYTLHLQMRGDCKVRLEE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crpNP_001285976.1 HLH 97..148 CDD:278439 18/51 (35%)
BHLH101NP_196035.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4835
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.