DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crp and bHLH38

DIOPT Version :9

Sequence 1:NP_001285976.1 Gene:crp / 34956 FlyBaseID:FBgn0001994 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_191256.1 Gene:bHLH38 / 824864 AraportID:AT3G56970 Length:253 Species:Arabidopsis thaliana


Alignment Length:221 Identity:50/221 - (22%)
Similarity:86/221 - (38%) Gaps:46/221 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YNSAEELDEELQLQLEDSGGENYHIEFASESAHQGSQRRQSSMSGTNTSKGGGGGGSGALSDGDG 84
            |.:.:.|:....|:|  :..:.|.:     :.||.|       .|.:.|..|          .:.
plant    24 YGAGDNLNNGTFLEL--TVPQTYEV-----THHQNS-------LGVSVSSEG----------NEI 64

  Fly    85 SGKPLVDSEKRMRREIANSNERRRMQSINAGFQSLRSLLP-RHEGEKLSKAAILQQTFQYIVELE 148
            ...|:|  .|::..   |::||.|.:.||..|.||||.|| ..:.:|||....:.::.:||.||:
plant    65 DNNPVV--VKKLNH---NASERDRRKKINTLFSSLRSCLPASDQSKKLSIPETVSKSLKYIPELQ 124

  Fly   149 NQKTQLLTQNSELKRQVGEHEAGGSGDGGGTNSGGNYNDSNASGGNSTAVAIKKRKLTDNVINIQ 213
            .|..:|:.:..|:..:|           .|......|:........|....:...:|.||.:.:|
plant   125 QQVKRLIQKKEEILVRV-----------SGQRDFELYDKQQPKAVASYLSTVSATRLGDNEVMVQ 178

  Fly   214 AISD-----SSDEGLGSMSPEPMTLL 234
            ..|.     |....||.:..:...|:
plant   179 VSSSKIHNFSISNVLGGIEEDGFVLV 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crpNP_001285976.1 HLH 97..148 CDD:278439 19/51 (37%)
bHLH38NP_191256.1 HLH 72..124 CDD:278439 20/54 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4835
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.