DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crp and BHLH100

DIOPT Version :9

Sequence 1:NP_001285976.1 Gene:crp / 34956 FlyBaseID:FBgn0001994 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_181657.1 Gene:BHLH100 / 818723 AraportID:AT2G41240 Length:242 Species:Arabidopsis thaliana


Alignment Length:199 Identity:52/199 - (26%)
Similarity:95/199 - (47%) Gaps:27/199 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 SGKPLVDSEKRMRREIANSNERRRMQSINAGFQSLRSLL-PRHEGEKLSKAAILQQTFQYIVELE 148
            :.:.|:|:...|::...|::||.|.:.||..|.||||.| |.::.:|||.:|.:.|..:||.||:
plant    50 NNRTLLDNPVVMKKLNHNASERERRKKINTMFSSLRSCLPPTNQTKKLSVSATVSQALKYIPELQ 114

  Fly   149 NQKTQLLTQNSELKRQV-GEHEAGGSGDGGGTNSGGNYNDSNA---SGGNSTAVAIKKRKLTDNV 209
            .|..:|:.:..||..|: |:.:.             .|.|.|:   .|..|.|..:...:|::..
plant   115 EQVKKLMKKKEELSFQISGQRDL-------------VYTDQNSKSEEGVTSYASTVSSTRLSETE 166

  Fly   210 INIQAISDSSDE-----GLGSMSPEPMTLLTAGGAAATKLSNAATLLAAKELHESKKQLEKERSL 269
            :.:|..|..:::     .|..:..:.:.|:   ||:::: |:...|..:..|.....|:..|...
plant   167 VMVQISSLQTEKCSFGNVLSGVEEDGLVLV---GASSSR-SHGERLFYSMHLQIKNGQVNSEELG 227

  Fly   270 RRLL 273
            .|||
plant   228 DRLL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crpNP_001285976.1 HLH 97..148 CDD:278439 21/51 (41%)
BHLH100NP_181657.1 bHLH_AtORG2_like 62..136 CDD:381484 28/73 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4835
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.