DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crp and TFAP4

DIOPT Version :9

Sequence 1:NP_001285976.1 Gene:crp / 34956 FlyBaseID:FBgn0001994 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_003214.1 Gene:TFAP4 / 7023 HGNCID:11745 Length:338 Species:Homo sapiens


Alignment Length:406 Identity:107/406 - (26%)
Similarity:164/406 - (40%) Gaps:155/406 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 DSEKRMRREIANSNERRRMQSINAGFQSLRSLLPRHEGEKLSKAAILQQTFQYIVELENQKTQLL 155
            |.|:|:|||||||||||||||||||||||::|:|..:|||||||||||||.:||..||.:||:||
Human    43 DQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLL 107

  Fly   156 TQNSELKRQVGEHEAGGSGDGGGTNSGGNYNDSNASGGNSTAVAIKKRKLTDNVINIQAISDSSD 220
            .||::|||.:  .|..||..                         |:|:..|           .|
Human   108 QQNTQLKRFI--QELSGSSP-------------------------KRRRAED-----------KD 134

  Fly   221 EGLGSMSPEPMTLLTAGGAAATKLSNAATLLAAKELHESKKQLEKERSLRRLLEDELQMIKRQLY 285
            ||:|  ||:           ..:...|..|  .:|:.|.::||:||||:|.:||::::.::..:|
Human   135 EGIG--SPD-----------IWEDEKAEDL--RREMIELRQQLDKERSVRMMLEEQVRSLEAHMY 184

  Fly   286 SVATAPPGTAVAAASGGSSGAYIPREVIEHTDNFVRSEDLEELGGTVSYVEIDEMTGQQQVVVCS 350
            .                                       |:|......|::.:...|.:::...
Human   185 P---------------------------------------EKLKVIAQQVQLQQQQEQVRLLHQE 210

  Fly   351 SIEELEADAAAEIITED-QVHEEVILSSNSSTESENEVNVNAIAKAYAEGCTSSAAMLQPILQAA 414
            .:|..:.....:::... ..|...::.........:.:||..:..:......|::          
Human   211 KLEREQQQLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGPSSVINSVSTS---------- 265

  Fly   415 IKATPKVEVERIHEKIVKVKTEKHDLPSMQTAPHYQHSHRQNLETIVQAIRHLEGDHLFADGSGG 479
                                                   ||||:||||||:|:||.         
Human   266 ---------------------------------------RQNLDTIVQAIQHIEGT--------- 282

  Fly   480 QEKFGQQQNLQQHHHQ 495
            |||    |.|::...:
Human   283 QEK----QELEEEQRR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crpNP_001285976.1 HLH 97..148 CDD:278439 40/50 (80%)
TFAP4NP_003214.1 HLH 49..100 CDD:306515 40/50 (80%)
Leucine-zipper 1 100..120 10/21 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..141 11/60 (18%)
Leucine-zipper 2 151..179 12/29 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..338 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158193
Domainoid 1 1.000 82 1.000 Domainoid score I8465
eggNOG 1 0.900 - - E1_KOG0561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4378
Isobase 1 0.950 - 0 Normalized mean entropy S6439
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565841at2759
OrthoFinder 1 1.000 - - FOG0006895
OrthoInspector 1 1.000 - - oto91107
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15741
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5799
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.