DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4935 and Taf5

DIOPT Version :9

Sequence 1:NP_609782.2 Gene:CG4935 / 34955 FlyBaseID:FBgn0028897 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_476957.1 Gene:Taf5 / 47900 FlyBaseID:FBgn0010356 Length:704 Species:Drosophila melanogaster


Alignment Length:175 Identity:50/175 - (28%)
Similarity:83/175 - (47%) Gaps:7/175 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VRYNVDGTYCLSCGSDKKIKLWNPASGLLLKTYGGHADEVTDAAGSCDSSYIVSASLDKSIIYWD 87
            ||:...|.|.:||..||..:||...|...|:.:.||..:|.......:|:|:.:.|.|:::..||
  Fly   498 VRFAPHGYYFVSCSYDKTARLWATDSNQALRVFVGHLSDVDCVQFHPNSNYVATGSSDRTVRLWD 562

  Fly    88 VSTGAPVRRLRSHAGGVRCVCFNEDSSIAISGGRDNAVMCWDIRTRRLDPVQVMKEARDCITTVA 152
            ..||..||.:..|.|.|..:.|:.......||..|:.::.||:....|  |..:......:||:.
  Fly   563 NMTGQSVRLMTGHKGSVSSLAFSACGRYLASGSVDHNIIIWDLSNGSL--VTTLLRHTSTVTTIT 625

  Fly   153 TNENR--IYAASLDGCVRTYDIRVGELTCDKIGEPITYLAQTRDE 195
            .:.:.  :.||.||..:..:|..  ::|.|.|...|| ::..:||
  Fly   626 FSRDGTVLAAAGLDNNLTLWDFH--KVTEDYISNHIT-VSHHQDE 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4935NP_609782.2 WD40 10..>302 CDD:225201 50/175 (29%)
WD40 10..281 CDD:238121 50/175 (29%)
WD40 repeat 21..57 CDD:293791 12/33 (36%)
WD40 repeat 62..98 CDD:293791 11/35 (31%)
WD40 repeat 105..135 CDD:293791 6/29 (21%)
WD40 repeat 140..178 CDD:293791 7/39 (18%)
WD40 repeat 186..222 CDD:293791 4/10 (40%)
WD40 repeat 229..254 CDD:293791
Taf5NP_476957.1 TAF5_NTD2 114..245 CDD:176269
WD40 319..674 CDD:225201 50/175 (29%)
WD40 373..646 CDD:238121 42/149 (28%)
WD40 repeat 380..448 CDD:293791
WD40 repeat 454..490 CDD:293791
WD40 repeat 495..531 CDD:293791 12/32 (38%)
WD40 repeat 538..573 CDD:293791 10/34 (29%)
WD40 repeat 579..615 CDD:293791 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.