DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twe and CDC25A

DIOPT Version :9

Sequence 1:NP_001260491.1 Gene:twe / 34954 FlyBaseID:FBgn0002673 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001780.2 Gene:CDC25A / 993 HGNCID:1725 Length:524 Species:Homo sapiens


Alignment Length:444 Identity:133/444 - (29%)
Similarity:201/444 - (45%) Gaps:105/444 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DPHDADMEYQAKRRKSAVQETPLQWMLKRHIPASTTVLSPITELSQNMNGARLDGTPKSTQRIPA 90
            || |.:.|.:|...|..|:                    |::....:.:|.: :|....|||   
Human   136 DP-DENKENEAFEFKKPVR--------------------PVSRGCLHSHGLQ-EGKDLFTQR--- 175

  Fly    91 NRTLNNFNSLSSRTLGSFSSSCSSYESGNSL----------------DDEYMDMFEMESAENHNL 139
                  .||..:|.|.  |:...|.|.||.:                ||.::|:.:.|:.:|.. 
Human   176 ------QNSAPARMLS--SNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEE- 231

  Fly   140 ELPDDLEVLLSGQL-KSESNLEEMSNKKGSLRRCLSMYPS--EQPEEAVQE-------------- 187
            |.|..:..|.:..| ...:||:.......|...|.|...|  ::||.:.:|              
Human   232 ETPSCMASLWTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSG 296

  Fly   188 --PDQETNMPMKKMQ--RKTLSMNDA---EIMRALGDEP-ELIGDLSKPCTLPCLATGIRHRDLK 244
              |.:.|| |.|..:  .::||:..:   .|...|.::| :||||.||......:|.  :|:|||
Human   297 ASPKESTN-PEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAG--KHQDLK 358

  Fly   245 TISSDTLARLIQGEFDEQLGSQGGYEIIDCRYPYEFLGGHIRGAKNLYTRGQIQEAF--PTLTSN 307
            .||.:.:|.::.|:|...:..   :.|||||||||:.||||:||.||:...::::..  ..:...
Human   359 YISPEIMASVLNGKFANLIKE---FVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT 420

  Fly   308 QENRRIYVFHCEFSSERGPKLLRYLRSNDRSQHTHNYPALDYPELYILHNGYKEFFGLYSQLCQP 372
            ...|.|.||||||||||||::.||:|..||.  .:.||.|.|||||:|..||||||......|:|
Human   421 DGKRVIVVFHCEFSSERGPRMCRYVRERDRL--GNEYPKLHYPELYVLKGGYKEFFMKCQSYCEP 483

  Fly   373 SQYVPMLAPAHNDEF----RYFRAKTKSWQCGEGGDSGIGGGGSRGLRKSRSRL 422
            ..|.||    |:::|    :.||.|:::|            .|.:..|:..|||
Human   484 PSYRPM----HHEDFKEDLKKFRTKSRTW------------AGEKSKREMYSRL 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tweNP_001260491.1 Cdc25 243..363 CDD:238788 56/121 (46%)
CDC25ANP_001780.2 Phosphodegron 74..84
M-inducer_phosp 86..328 CDD:310900 48/226 (21%)
KEN box 141..143 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..317 11/53 (21%)
Cdc25 357..475 CDD:238788 57/122 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148391
Domainoid 1 1.000 114 1.000 Domainoid score I6064
eggNOG 1 0.900 - - E1_COG5105
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 203 1.000 Inparanoid score I3749
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1423329at2759
OrthoFinder 1 1.000 - - FOG0000931
OrthoInspector 1 1.000 - - mtm8627
orthoMCL 1 0.900 - - OOG6_101194
Panther 1 1.100 - - O PTHR10828
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R583
SonicParanoid 1 1.000 - - X695
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.