DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twe and YCH1

DIOPT Version :9

Sequence 1:NP_001260491.1 Gene:twe / 34954 FlyBaseID:FBgn0002673 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_011719.1 Gene:YCH1 / 853117 SGDID:S000003435 Length:148 Species:Saccharomyces cerevisiae


Alignment Length:108 Identity:29/108 - (26%)
Similarity:51/108 - (47%) Gaps:18/108 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 YEIIDCRYPYEFLGGHIR-GAKNLYTR-----GQIQEAFPTLTSNQENRR---IYVFHCEFSSER 324
            ::::|.| ..:::||||: |....|:|     ..::|....|...|.:.|   ..:|||..|.:|
Yeast    33 FQVVDVR-GSDYMGGHIKDGWHYAYSRLKQDPEYLRELKHRLLEKQADGRGALNVIFHCMLSQQR 96

  Fly   325 GPK-LLRYLRSNDRSQHTHNYPALDYPELYILHNGYKEFFGLY 366
            ||. .:..|||.|.::       |....|::|..|:..:..:|
Yeast    97 GPSAAMLLLRSLDTAE-------LSRCRLWVLRGGFSRWQSVY 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tweNP_001260491.1 Cdc25 243..363 CDD:238788 28/103 (27%)
YCH1NP_011719.1 Acr2p 9..132 CDD:238789 28/106 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.