DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twe and Cdc25c

DIOPT Version :9

Sequence 1:NP_001260491.1 Gene:twe / 34954 FlyBaseID:FBgn0002673 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_008770261.1 Gene:Cdc25c / 307511 RGDID:1311875 Length:455 Species:Rattus norvegicus


Alignment Length:476 Identity:146/476 - (30%)
Similarity:210/476 - (44%) Gaps:133/476 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YQAKRRKSAVQETPLQWMLKRHIPASTTV-----LSPITELSQNMNGARLD-GTPKSTQRIPANR 92
            ::.|:||.      |..:|:||  ||.||     .||..:|..:.|.:.|. ||||...      
  Rat    21 FRFKQRKM------LHLLLERH--ASFTVGSDFPESPGDKLHDSANLSLLSGGTPKCCL------ 71

  Fly    93 TLNNFNSLSS-RTLGSFSSSCSSYESGNSLD------------DEYMDMFE-------------- 130
               :.:|||: ....|..|:.:..|...|||            |.:.|:.:              
  Rat    72 ---DLSSLSNGEVSASHLSTSADIEENGSLDSSGPQDIHLTGKDFHQDLMKGIPAQLLCSTPNAL 133

  Fly   131 -----------MESAENHNL---------ELPD-----------------DLE--VLLSGQLKS- 155
                       ..||...|:         |.|.                 :||  :||..::|: 
  Rat   134 DHGHRRKDAKCSTSANKENINTSFKTLEWEAPRTPRLQKKPGDPLASPLCELENGILLESEMKNL 198

  Fly   156 ----------ESNLEEMSNKKGSLRRCLSMYPSEQPEEAVQEPDQETNMPMKKMQRKTLSMNDAE 210
                      ..|| ::.:::|.         ||.|.|...|......:.:||.. ....|:..|
  Rat   199 GSPITTVPKLSKNL-KLEDQEGI---------SEDPMECSLEDQDAKGLSLKKTV-PLCGMDAIE 252

  Fly   211 IMRALGDEPELIGDLSKPCTLPCLATGIRHRDLKTISSDTLARLIQGEFDEQLGSQGGYEIIDCR 275
            :.....|...|.||.||.|.||.:..  :|:|||.||.||:|.|:.|:|...:..   :.|||||
  Rat   253 LEEEDSDSEHLTGDFSKACVLPTVPG--KHQDLKYISPDTVAALLSGKFQSVIER---FYIIDCR 312

  Fly   276 YPYEFLGGHIRGAKNLYTRGQIQEAF---PTLTSNQENRRIYVFHCEFSSERGPKLLRYLRSNDR 337
            ||||:|||||.||.|||::.::.|.|   |.:..:.:.|.|.||.|||||||||::.|.||..||
  Rat   313 YPYEYLGGHILGALNLYSQKELYEFFLKKPVVPEDTQKRVIIVFLCEFSSERGPRMCRSLREKDR 377

  Fly   338 SQHTHNYPALDYPELYILHNGYKEFFGLYSQLCQPSQYVPMLAPAHNDEFRYFRAKTKSWQCGEG 402
            :  .:.||||.|||||||..||::||..|.:||:|..|.|||...|..|...:|:::|:.:    
  Rat   378 A--LNQYPALYYPELYILRGGYRDFFPEYMELCEPQGYCPMLHQDHQAELLSWRSQSKAQE---- 436

  Fly   403 GDSGIGGGGSRGLRKSRSRLL 423
                    |.|.||:..:.|:
  Rat   437 --------GERQLREQIALLV 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tweNP_001260491.1 Cdc25 243..363 CDD:238788 63/122 (52%)
Cdc25cXP_008770261.1 Cdc25 283..402 CDD:238788 64/123 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I5909
eggNOG 1 0.900 - - E1_COG5105
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1423329at2759
OrthoFinder 1 1.000 - - FOG0000931
OrthoInspector 1 1.000 - - mtm9106
orthoMCL 1 0.900 - - OOG6_101194
Panther 1 1.100 - - O PTHR10828
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X695
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.