DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twe and ibp1

DIOPT Version :9

Sequence 1:NP_001260491.1 Gene:twe / 34954 FlyBaseID:FBgn0002673 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_595247.1 Gene:ibp1 / 2541214 PomBaseID:SPBC839.07 Length:138 Species:Schizosaccharomyces pombe


Alignment Length:133 Identity:35/133 - (26%)
Similarity:55/133 - (41%) Gaps:31/133 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LKTISSDTLARLIQGEFDEQLGSQGGYEIIDCRYPYEFLGGHIRGAKNLYTRGQIQEAFPTLTSN 307
            |..:|.|.|...:       :.|.....|||.| .|::.|..|.|:..:.:     :.|  |.|.
pombe     4 LSYVSPDALKGWL-------MESPNEISIIDVR-DYDYEGERIPGSVRIPS-----DTF--LASV 53

  Fly   308 QEN------RRIYVFHCEFSSERGPKLLRYLRSNDRSQHTHNYPAL----------DYPELYILH 356
            .::      :|..:.||.:|..||||..|.|....|::.|.:...|          :.|.:||||
pombe    54 DQHVDDLMKKRSLIVHCTYSQVRGPKAARVLSEILRNRITESKEKLSLSQKEKLFQNLPTVYILH 118

  Fly   357 NGY 359
            .|:
pombe   119 GGF 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tweNP_001260491.1 Cdc25 243..363 CDD:238788 35/133 (26%)
ibp1NP_595247.1 Acr2p 4..128 CDD:238789 35/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R583
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.