DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twe and cdc25c

DIOPT Version :9

Sequence 1:NP_001260491.1 Gene:twe / 34954 FlyBaseID:FBgn0002673 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_031753389.1 Gene:cdc25c / 100124300 XenbaseID:XB-GENE-944821 Length:567 Species:Xenopus tropicalis


Alignment Length:374 Identity:133/374 - (35%)
Similarity:189/374 - (50%) Gaps:83/374 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 LGSFSSSCSSYESGNSLD------DEYMDMFEMESAENHNL-----ELPDDLEVLLSGQLKSE-- 156
            |||..|:.:....|...|      |.:.|.|.::..|..|.     .|...:.:||||.|.::  
 Frog   220 LGSPISAAAPCLEGPHDDIKMQNLDGFADFFSVDEEEIENPSGAVGNLSSSMAILLSGPLLNQEV 284

  Fly   157 --SNLEEMSNKKGSLRRCLSMYPSEQPEE--------AVQEPDQETNMPMKKMQ----------- 200
              ||:..:|..:..|.|..||     ||:        .|:..|.||.:.:|:.:           
 Frog   285 EVSNVNNISLNRSRLYRSPSM-----PEKLDRPMLKRTVRPQDSETPVRIKRRRSTSSPLQPEEE 344

  Fly   201 -----------RKTLSMNDAEIMRALGDE---PELIGDLSKPCTLPCLATGIRHRDLKTISSDTL 251
                       :||||:.|.:|...|.::   .:||||.||...||.: || ||:||:.|:::||
 Frog   345 NCQPRRRGTSLKKTLSLCDVDISTVLDEDCGHRQLIGDFSKVYALPTV-TG-RHQDLRYITAETL 407

  Fly   252 ARLIQGEFDEQLGSQGGYEIIDCRYPYEFLGGHIRGAKNLYTRGQIQEAF---PTLTSNQENRRI 313
            |.||.|:|...:.:   ..|||||||||:.||||:||.||:.:.::.:.|   |...|..:.|.|
 Frog   408 AALIHGDFSSLVEN---VFIIDCRYPYEYDGGHIKGALNLHRQEEVTDYFLKQPLAPSVAQKRLI 469

  Fly   314 YVFHCEFSSERGPKLLRYLRSNDRSQHTHNYPALDYPELYILHNGYKEFFGLYSQLCQPSQYVPM 378
            .|||||||||||||:.|:||..||::  :.||.|.|||||:|..|||:||..|.:||:|..|.||
 Frog   470 IVFHCEFSSERGPKMCRFLREEDRAR--NEYPGLYYPELYLLKGGYKDFFPEYKELCEPQGYCPM 532

  Fly   379 LAPAHNDEFR----YFRAKTKSWQCGEGGDSGIGGGGSRGLRKSRSRLL 423
                |:.:||    .||.|.|:            ..|.|..|:..:||:
 Frog   533 ----HHQDFREELLKFRTKCKT------------SVGDRKRREQIARLM 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tweNP_001260491.1 Cdc25 243..363 CDD:238788 61/122 (50%)
cdc25cXP_031753389.1 M-inducer_phosp 137..368 CDD:399542 37/152 (24%)
Cdc25 399..518 CDD:238788 62/123 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 199 1.000 Inparanoid score I3672
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1423329at2759
OrthoFinder 1 1.000 - - FOG0000931
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X695
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.