DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoGI and YKU70

DIOPT Version :9

Sequence 1:NP_001260489.1 Gene:EndoGI / 34953 FlyBaseID:FBgn0028515 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_014011.1 Gene:YKU70 / 855328 SGDID:S000004897 Length:602 Species:Saccharomyces cerevisiae


Alignment Length:391 Identity:80/391 - (20%)
Similarity:139/391 - (35%) Gaps:120/391 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LIETRVQVDEIVDDDVTKENFDRTAAA------------ARDVIWRLLFDEAGTSQSNTEKASQL 91
            |:|....:||::...|    ..|...|            |::.|:. ||.....:.:..:|.:.|
Yeast    55 LLEILESLDELMSQLV----ITRPGTAIGCYFYYCNREDAKEGIYE-LFPLRDINATFMKKLNDL 114

  Fly    92 LEEY-RGDACFYDPTPY----NEWIVKLRDEVLKKELLD-FWRDVLVKKQLG------------P 138
            ||:. .|....||...:    :|..|:|  .||...:|| |..::..:|||.            |
Yeast   115 LEDLSSGRISLYDYFMFQQTGSEKQVRL--SVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKP 177

  Fly   139 CWSRD-----------SDLFDSD-----------DTP-PLEFYAHAGCTAPFAASLKVRAALEEQ 180
            ..::|           .||||:.           |.| ..|||:..         |::.:...|.
Yeast   178 QEAQDIDERARLRRLTIDLFDNKVNFATFFIGYADKPFDNEFYSDI---------LQLGSHTNEN 233

  Fly   181 ASLDQ--DGPATPTTPGELSADDAAALSGEFEATLTKENPL--EEYRTLMKRFVL-----TKIIV 236
            ..||.  |||:|.                ..:|...|...|  :|.:.:|.:..|     |..||
Yeast   234 TGLDSEFDGPSTK----------------PIDAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIV 282

  Fly   237 PDSVHQASVKKIAAAARE---IIWKLLFDGTPSAEDQNKAAELLQEYKGD--AGF------YGPD 290
                   .||.......|   :.:||:::.....::.....:.|....|:  .|.      ||..
Yeast   283 -------GVKGYTMYTHEKAGVRYKLVYEHEDIRQEAYSKRKFLNPITGEDVTGKTVKVYPYGDL 340

  Fly   291 DYNSWIFNLRDEVLTKELLDFWRDKMVKMELGPSCARDSDYYDNEDPLPFEFYEKAGCKAPFEGP 355
            |.|  :.:.:|:::.:....  :|..:|:....|.::...|::|.|...|...:    :|.:||.
Yeast   341 DIN--LSDSQDQIVMEAYTQ--KDAFLKIIGFRSSSKSIHYFNNIDKSSFIVPD----EAKYEGS 397

  Fly   356 V 356
            :
Yeast   398 I 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGINP_001260489.1 Ku_PK_bind 31..138 CDD:285938 29/128 (23%)
YKU70NP_014011.1 Ku_N 31..267 CDD:397685 52/243 (21%)
KU70 265..553 CDD:238407 28/149 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12604
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.