DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoGI and YKU80

DIOPT Version :9

Sequence 1:NP_001260489.1 Gene:EndoGI / 34953 FlyBaseID:FBgn0028515 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_013824.1 Gene:YKU80 / 855132 SGDID:S000004712 Length:629 Species:Saccharomyces cerevisiae


Alignment Length:299 Identity:51/299 - (17%)
Similarity:89/299 - (29%) Gaps:121/299 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TIGLVDPVKDY-------------QKLIETRVQV---------------------DEIVDDDVTK 56
            |||.:..:|.|             |.:|:..:.|                     |.:.|.|:|.
Yeast    80 TIGFIKRLKQYCDQHSHDSSNEGLQSMIQCLLVVSLDIKQQFQARKILKQIVVFTDNLDDLDITD 144

  Fly    57 ENFDRTAAAARDVIWRLLFDEAGTSQSNTEKASQLLE--EYRGDACFYDPTPYNEWIVKLRD--- 116
            |..|   ....::..|::..:.|.......|.|..|:  |...::..|:   .||.:|::..   
Yeast   145 EEID---LLTEELSTRIILIDCGKDTQEERKKSNWLKLVEAIPNSRIYN---MNELLVEITSPAT 203

  Fly   117 ------EVLKKELLDFWRDVLVKKQLGPCWSRDSDLFDSDDTPPLEFYAHAGCTAPFAASLKVRA 175
                  .|...||           :||      :|:..:..:.|........|..     :||.|
Yeast   204 SVVKPVRVFSGEL-----------RLG------ADILSTQTSNPSGSMQDENCLC-----IKVEA 246

  Fly   176 ALEEQASLDQDGPATPTTPG------------------------------------ELSADDAAA 204
            .           |||....|                                    .:|.||.:.
Yeast   247 F-----------PATKAVSGLNRKTAVEVEDSQKKERYVGVKSIIEYEIHNEGNKKNVSEDDQSG 300

  Fly   205 LSGEFEATLTKENPLEEYRTLMKRFVLTKIIVPDSVHQA 243
             |.....|::|::..:.||......||..::|..:|:::
Yeast   301 -SSYIPVTISKDSVTKAYRYGADYVVLPSVLVDQTVYES 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGINP_001260489.1 Ku_PK_bind 31..138 CDD:285938 25/151 (17%)
YKU80NP_013824.1 vWFA 5..232 CDD:412136 31/174 (18%)
KU80 244..583 CDD:238445 18/107 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343945
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003754
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.