DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoGI and KU70

DIOPT Version :9

Sequence 1:NP_001260489.1 Gene:EndoGI / 34953 FlyBaseID:FBgn0028515 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_564012.1 Gene:KU70 / 838268 AraportID:AT1G16970 Length:621 Species:Arabidopsis thaliana


Alignment Length:201 Identity:47/201 - (23%)
Similarity:71/201 - (35%) Gaps:67/201 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 SDLFDSDDTPPLEFYAHAGCTAPFAA--SLKVRAALEEQASLDQDGPATPTTPGELSADDAAALS 206
            :|:.|.|     |.::..|..||.|:  .||..:||..:..|..........|         ||.
plant   448 NDIRDID-----ELHSKPGVAAPRASDDQLKKASALMRRLELKDFSVCQFANP---------ALQ 498

  Fly   207 GEF---EATLTKENPLEEYR--TLMKRFVLTKIIVPD--SVHQASVKKIAAAAREIIWKLLFDGT 264
            ..:   :|....||.|.|.|  ||           ||  .:::.:|.|    |.|...:.::...
plant   499 RHYAILQAIALDENELRETRDETL-----------PDEEGMNRPAVVK----AIEQFKQSIYGDD 548

  Fly   265 PSAEDQNKAAELLQEYK-GDA--GFYGPDDY-----------------------NSWIFNLRDEV 303
            |..|..:.|.|..::.| |||  |.|   ||                       |:.:.:.:.||
plant   549 PDEESDSGAKEKSKKRKAGDADDGKY---DYIELAKTGKLKDLTVVELKTYLTANNLLVSGKKEV 610

  Fly   304 LTKELL 309
            |...:|
plant   611 LINRIL 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGINP_001260489.1 Ku_PK_bind 31..138 CDD:285938
KU70NP_564012.1 ku70 24..619 CDD:273151 47/201 (23%)
KU70 265..544 CDD:238407 30/124 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12604
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.