Sequence 1: | NP_001260489.1 | Gene: | EndoGI / 34953 | FlyBaseID: | FBgn0028515 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005700.1 | Gene: | xrcc6 / 448213 | XenbaseID: | XB-GENE-970899 | Length: | 611 | Species: | Xenopus tropicalis |
Alignment Length: | 327 | Identity: | 75/327 - (22%) |
---|---|---|---|
Similarity: | 110/327 - (33%) | Gaps: | 106/327 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 108 NEW---IVKLRDEVLKKELLDFWRDVLVKKQLGPCWSRDSDLFDSDDTPPLEFYAHAGCTAPFAA 169
Fly 170 SLK-VRAALEEQ-ASLDQD------------GPATP----------TTPGE---LSAD------- 200
Fly 201 -----DAAALSGEF---EATLTKENPLEEYRTLM--KRFVL-TKIIVPDSVHQASVKKIAAAARE 254
Fly 255 IIWKLLF-------------------DGTPSAEDQN-----KAAE----LLQEYKGDAG------ 285
Fly 286 ----FYGPD-DYNSWIFNLRDEVLTKELLDFWRD--KMVKME-----------LGPSCARDSDYY 332
Fly 333 DN 334 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
EndoGI | NP_001260489.1 | Ku_PK_bind | 31..138 | CDD:285938 | 11/32 (34%) |
xrcc6 | NP_001005700.1 | Ku_C | 27..609 | CDD:330205 | 65/301 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12604 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |