DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoGI and xrcc6

DIOPT Version :9

Sequence 1:NP_001260489.1 Gene:EndoGI / 34953 FlyBaseID:FBgn0028515 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001005700.1 Gene:xrcc6 / 448213 XenbaseID:XB-GENE-970899 Length:611 Species:Xenopus tropicalis


Alignment Length:327 Identity:75/327 - (22%)
Similarity:110/327 - (33%) Gaps:106/327 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 NEW---IVKLRDEVLKKELLDFWRDVLVKKQLGPCWSRDSDLFDSDDTPPLEFYAHAGCTAPFAA 169
            |||   .||..||. .:|..:..||..|.:..|    |||.:|..|.:.|: |.:......||..
 Frog     2 NEWGEYFVKEEDED-DEEQEEGERDAGVFRFAG----RDSLIFLIDASKPM-FESTGDELTPFDL 60

  Fly   170 SLK-VRAALEEQ-ASLDQD------------GPATP----------TTPGE---LSAD------- 200
            :|: :|:....: .|.|.|            ....|          .|||.   |..|       
 Frog    61 TLQCIRSVYASKIISSDHDLLSVVFFGTRESNNCDPFKHLCVLHDLDTPGAKRILDLDKYKEEKG 125

  Fly   201 -----DAAALSGEF---EATLTKENPLEEYRTLM--KRFVL-TKIIVPDSVHQASVKKIAAAARE 254
                 |.....|:|   ||.....|.....:..|  ||.:| |....|.:..||..|:..|.|.:
 Frog   126 RALFRDTIGCGGDFSLGEALWLCSNLFSNVKVKMSHKRIMLFTNEDNPHANDQAKAKQARAKAED 190

  Fly   255 IIWKLLF-------------------DGTPSAEDQN-----KAAE----LLQEYKGDAG------ 285
            :....:|                   |...:||||:     ||:|    ||::.:....      
 Frog   191 LREMGIFLDLMHLEKPEGFDISLFYRDIVNTAEDQDLGVQFKASEKLDDLLKKVRAKEAKKRALA 255

  Fly   286 ----FYGPD-DYNSWIFNLRDEVLTKELLDFWRD--KMVKME-----------LGPSCARDSDYY 332
                ..||| .....|:||..:.:....:..:|:  :.||.:           |.||..:.|..|
 Frog   256 RLTLKLGPDVGLTVGIYNLVQKAVKPPTVKLYRESNEPVKTKTRIFHSNTGSLLLPSDTKRSQTY 320

  Fly   333 DN 334
            .|
 Frog   321 GN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGINP_001260489.1 Ku_PK_bind 31..138 CDD:285938 11/32 (34%)
xrcc6NP_001005700.1 Ku_C 27..609 CDD:330205 65/301 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12604
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.