DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoGI and Xrcc5

DIOPT Version :9

Sequence 1:NP_001260489.1 Gene:EndoGI / 34953 FlyBaseID:FBgn0028515 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_038939801.1 Gene:Xrcc5 / 363247 RGDID:3976 Length:744 Species:Rattus norvegicus


Alignment Length:324 Identity:63/324 - (19%)
Similarity:113/324 - (34%) Gaps:117/324 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VKDYQKLIETRVQ---VDEIVDD-DVTKENFDRTAAAARDVIWRLLFDEAGTSQSNTEKASQLLE 93
            :|:.:|...|..|   :|:::|. .:.|:|.:      .|:| ..||..:.......::..|.| 
  Rat   438 LKNNKKCTPTEAQLSAIDDLIDSMSLVKKNEE------EDII-EDLFPTSKIPNPEFQRLYQCL- 494

  Fly    94 EYRGDACFYDPTPYNEWIVKLRDEVLKKELLDFWRDVLVKKQLGPCWSRDSDLFDSDDTPPLEFY 158
                                            ..|.:.::::|.|......::.|    ||.|. 
  Rat   495 --------------------------------LHRALHLQERLPPIQQHILNMLD----PPTEM- 522

  Fly   159 AHAGCTAPFAASLKVRAAL--------EEQASLD-------QDGPA-----TPTTPGELSADDAA 203
             .|.|..|.:   ||:...        ::|.:..       ::|||     |....|.:|....|
  Rat   523 -KAKCEIPLS---KVKTLFPLTEVVKKKDQVTAQDVFQDNIEEGPAAKKYKTEKEEGHISISSLA 583

  Fly   204 ALSGEFEATLTK---ENPLEEYRTLMKRFVLTKIIVPDSVHQASVKKIAAAAREI-----IWKLL 260
                  |..:||   .||:|.:|.|::                  :|||:...|:     .|:||
  Rat   584 ------EGNVTKVGSVNPVENFRVLVR------------------QKIASFEEELGTEPRAWRLL 624

  Fly   261 -----------FDGTPSAEDQNKAAELLQEYKGDA-GFYGPDDYNSWIFNLRDEVLTKELLDFW 312
                       |..|.......|:.:.::..:.:| .|.....:||::..||::|..|:|..||
  Rat   625 ASLQLMSHIEQFLDTNETLYFMKSMDCIKALREEAIQFSEEQRFNSFLEGLREKVEIKQLNHFW 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGINP_001260489.1 Ku_PK_bind 31..138 CDD:285938 16/108 (15%)
Xrcc5XP_038939801.1 Ku_N 9..244 CDD:397685
KU80 246..542 CDD:238445 26/152 (17%)
Ku_PK_bind 594..719 CDD:400921 26/113 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003754
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.