DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoGI and pku70

DIOPT Version :9

Sequence 1:NP_001260489.1 Gene:EndoGI / 34953 FlyBaseID:FBgn0028515 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001342782.1 Gene:pku70 / 2539090 PomBaseID:SPCC126.02c Length:607 Species:Schizosaccharomyces pombe


Alignment Length:142 Identity:32/142 - (22%)
Similarity:50/142 - (35%) Gaps:28/142 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 AAALSGEFEATLTKENPLEEYRTLMKRFVLTKIIVPDSVHQASVKKIAAAAREIIWKLLFDG-TP 265
            |.||..|...... :|.|.:|:.:.||.         ..:...|..|.|..|..|...  :| ..
pombe   477 ALALDEEIPTDFV-DNTLPKYKAIQKRV---------GEYMGDVNNIVAEYRNDISDK--NGIKE 529

  Fly   266 SAEDQNKAAELLQEYKGDAGFYGPDDYNSWIFNLRDEVLTKE--------LLDFWRDKMVKMELG 322
            ..|||....:..:..|.....:..||....::  .:.||.||        |.|..||:.:::.  
pombe   530 EEEDQGPIVKKARIEKSGKPIFAEDDRLKQLY--IEGVLDKEIKALKVSQLKDILRDRGLRVS-- 590

  Fly   323 PSCARDSDYYDN 334
               .:.:|..||
pombe   591 ---GKKADLLDN 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGINP_001260489.1 Ku_PK_bind 31..138 CDD:285938
pku70NP_001342782.1 Ku_C 16..605 CDD:330205 32/142 (23%)
KU70 234..514 CDD:238407 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12604
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.