DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoGI and cku-80

DIOPT Version :9

Sequence 1:NP_001260489.1 Gene:EndoGI / 34953 FlyBaseID:FBgn0028515 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001309438.1 Gene:cku-80 / 175578 WormBaseID:WBGene00000520 Length:713 Species:Caenorhabditis elegans


Alignment Length:168 Identity:33/168 - (19%)
Similarity:63/168 - (37%) Gaps:50/168 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VDPVKDYQKLI-------ETRVQVDEIVDDDVTKENFDRTAA---AARDVIWRLLFDEAGTSQSN 84
            |:| :|.|.:|       :...|.|| |||..:::...:..|   ..::.:...:.::.|.|:  
 Worm   554 VEP-EDLQTMISEWTEKKQNMTQPDE-VDDGASQKKKKKPNAKKLTRKEEVQMDIMEDGGASR-- 614

  Fly    85 TEKASQLLEEYRGDACFYDPT----------------------------PYNEWIVKLRDEVLKK 121
              ..|::||.. .:.|.:.|.                            .:||.:.||:||    
 Worm   615 --VCSKILEMI-SNTCKFQPNGAVTEFFTLLVNELNVIRSVFVENSKCDEFNELLKKLKDE---- 672

  Fly   122 ELLDFWRDVL-VKKQLGPCWSRDSDLFDSDDTPPLEFY 158
            |..:.:.:|| .:|...|..|.:..:.:.......||:
 Worm   673 EDFEPFAEVLSEEKSCNPIDSSEVSMSEVSVANAAEFW 710

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGINP_001260489.1 Ku_PK_bind 31..138 CDD:285938 28/145 (19%)
cku-80NP_001309438.1 vWFA 12..178 CDD:238119
KU80 229..542 CDD:238445
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003754
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.