DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoGI and Xrcc6

DIOPT Version :9

Sequence 1:NP_001260489.1 Gene:EndoGI / 34953 FlyBaseID:FBgn0028515 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_034377.2 Gene:Xrcc6 / 14375 MGIID:95606 Length:608 Species:Mus musculus


Alignment Length:255 Identity:53/255 - (20%)
Similarity:85/255 - (33%) Gaps:71/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KMATAEKVAQNDYTIGLVDPVKDYQKLIETRVQVDEIVDD---DVTKENFDRTAAAARDVIWRLL 74
            |....|.:|...||     |.|:........|..:|.:||   .||...|........|...::.
Mouse   386 KCVEKEVIAVCRYT-----PRKNVSPYFVALVPQEEELDDQNIQVTPGGFQLVFLPYADDKRKVP 445

  Fly    75 FDEAGT-SQSNTEKASQLLEE----YRGDACFYDPTPYNEWIVKLRDEVLKKELLDFWRDVLVKK 134
            |.|..| :|...:|...::::    ||.|: |.:|.        |:......|.|..        
Mouse   446 FTEKVTANQEQIDKMKAIVQKLRFTYRSDS-FENPV--------LQQHFRNLEALAL-------- 493

  Fly   135 QLGPCWSRDSDLFDSDDTPPLEFYAHAGCTAPFAASLKVRAALEEQASLDQDGPATPTTPG---- 195
                      |:.:|:....|        |.|     ||.|..:...||..:.......||    
Mouse   494 ----------DMMESEQVVDL--------TLP-----KVEAIKKRLGSLADEFKELVYPPGYNPE 535

  Fly   196 ----ELSADDAAALSGEFEATLTKENPLEEYRTLMKRFVLTKIIVPDSVHQASVKKIAAA 251
                :...||..:.|.:.:..|::    ||.:...::..|.|:.||      ::|.|..|
Mouse   536 GKVAKRKQDDEGSTSKKPKVELSE----EELKAHFRKGTLGKLTVP------TLKDICKA 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGINP_001260489.1 Ku_PK_bind 31..138 CDD:285938 23/114 (20%)
Xrcc6NP_034377.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
ku70 22..606 CDD:273151 53/255 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 534..557 3/22 (14%)
Interaction with DEAF1. /evidence=ECO:0000250 548..607 11/48 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12604
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.