DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoGI and Irbp

DIOPT Version :9

Sequence 1:NP_001260489.1 Gene:EndoGI / 34953 FlyBaseID:FBgn0028515 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_536773.1 Gene:Irbp / 117419 FlyBaseID:FBgn0011774 Length:631 Species:Drosophila melanogaster


Alignment Length:193 Identity:43/193 - (22%)
Similarity:65/193 - (33%) Gaps:50/193 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SNTEKAS---------QLLEEYRGDACFYDPTPYNEWIVKLRDEVLKKELLDFWRDVLVKKQLGP 138
            :|||..:         :::::.|.|   |.|...|:..:......|....|||..|.   |.|  
  Fly   467 NNTENTADEQKVEFFQKIIKKLRVD---YQPNLINDPSLDALQANLLALSLDFSTDT---KGL-- 523

  Fly   139 CWSRDSDLFDSDD--------TPPLEFYAHAGCTAPFAASLKVRAALEEQASLDQDGPATPTTPG 195
                 .:|.|:..        .|..|.:      ||.|...|.|||        :...|..:.|.
  Fly   524 -----DNLLDTSQQDKRIEKLLPDYEMF------APEAEPHKKRAA--------KSTTAGASGPK 569

  Fly   196 ELSADDAAALSGEFEATLTKENPLEEYRTLMKRFVLT---KIIVPDSVHQASVKKIAAAAREI 255
            ....||......||..:|.|:..|.........|:|.   .:.:|.|..:|   |:.|...|:
  Fly   570 MAKIDDDQLKEFEFVKSLNKDEALTSCTAAQLHFILQHHFDVTMPKSSKKA---KLVAKIEEL 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGINP_001260489.1 Ku_PK_bind 31..138 CDD:285938 15/63 (24%)
IrbpNP_536773.1 Ku_N 33..256 CDD:367627
KU70 255..546 CDD:238407 19/91 (21%)
HeH 593..624 CDD:338564 7/33 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449730
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12604
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.