DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRL-1 and Ptp4a2

DIOPT Version :9

Sequence 1:NP_001260487.1 Gene:PRL-1 / 34952 FlyBaseID:FBgn0024734 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_445927.2 Gene:Ptp4a2 / 85237 RGDID:619786 Length:167 Species:Rattus norvegicus


Alignment Length:168 Identity:97/168 - (57%)
Similarity:123/168 - (73%) Gaps:5/168 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RPAPALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAF 75
            ||||..|.|:.|:||||..|::.|:|.:..||||..|.|:||||:.:|:...:|.:||.|.|..|
  Rat     3 RPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPF 67

  Fly    76 EDGTFPPQQVVDEWFEVLKDKYQQNPEACVAVHCVAGLGRAPVLVALALIELGLKYEAAVEMIRD 140
            :||..||.|:||:|..:||.|:::.|..|||||||||||||||||||||||.|:|||.||:.||.
  Rat    68 DDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQ 132

  Fly   141 KRRGAINAKQLSFLEKYKPKARLKHK--NGHKNSCSVQ 176
            |||||.|:|||.:||||:||.||:.:  |||   |.||
  Rat   133 KRRGAFNSKQLLYLEKYRPKMRLRFRDTNGH---CCVQ 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRL-1NP_001260487.1 PTP-IVa 10..163 CDD:350350 89/151 (59%)
Ptp4a2NP_445927.2 PTP-IVa2 1..155 CDD:350512 89/151 (59%)
Phosphate binding. /evidence=ECO:0000250 102..107 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340145
Domainoid 1 1.000 139 1.000 Domainoid score I4655
eggNOG 1 0.900 - - E1_KOG2836
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I3639
OMA 1 1.010 - - QHG54094
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001421
OrthoInspector 1 1.000 - - otm46077
orthoMCL 1 0.900 - - OOG6_101823
Panther 1 1.100 - - O PTHR23339
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X788
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.