DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRL-1 and ptp4a3b

DIOPT Version :9

Sequence 1:NP_001260487.1 Gene:PRL-1 / 34952 FlyBaseID:FBgn0024734 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_005158234.1 Gene:ptp4a3b / 567691 ZFINID:ZDB-GENE-030131-2635 Length:173 Species:Danio rerio


Alignment Length:162 Identity:84/162 - (51%)
Similarity:117/162 - (72%) Gaps:2/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAFEDG 78
            |..:.|..|:|:||..|::.|::.:|.:||:.:..|||||||.:|:...||..||||.|..|:||
Zfish     9 PVEVCYNSMRFVITHNPTNQTLDTFIEDLKRYDAKTVVRVCESTYDKTPLEKHGITVMDWPFDDG 73

  Fly    79 TFPPQQVVDEWFEVLKDKYQQNPEACVAVHCVAGLGRAPVLVALALIELGLKYEAAVEMIRDKRR 143
            ..||.::||:|..:||..:.::|..||||||||||||||||||:||||.|:|||.|:.:||.||.
Zfish    74 APPPTKIVDDWISLLKKSFSEDPGCCVAVHCVAGLGRAPVLVAVALIEGGMKYEEAIHLIRLKRH 138

  Fly   144 GAINAKQLSFLEKYKPKARLKHKN--GHKNSC 173
            ||.|:|||::||||:.|.||:.|:  .|::.|
Zfish   139 GAFNSKQLTYLEKYRSKKRLRFKDPFKHRSKC 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRL-1NP_001260487.1 PTP-IVa 10..163 CDD:350350 79/148 (53%)
ptp4a3bXP_005158234.1 PTPc 11..160 CDD:328744 80/148 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 137 1.000 Domainoid score I4844
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 199 1.000 Inparanoid score I3757
OMA 1 1.010 - - QHG54094
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001421
OrthoInspector 1 1.000 - - otm24237
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23339
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X788
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.