DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRL-1 and ptp4a1

DIOPT Version :9

Sequence 1:NP_001260487.1 Gene:PRL-1 / 34952 FlyBaseID:FBgn0024734 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_021335279.1 Gene:ptp4a1 / 493615 ZFINID:ZDB-GENE-041121-11 Length:184 Species:Danio rerio


Alignment Length:168 Identity:96/168 - (57%)
Similarity:125/168 - (74%) Gaps:2/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RPAPALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAF 75
            ||||..|.||.|:||||..|::.|::.:|.||||..|.|||||||.:|:.:.:..:||.|.|..|
Zfish    17 RPAPVEITYKNMRFLITHNPTNATLHKFIEELKKYGVTTVVRVCEATYDANLVVKEGIQVLDWPF 81

  Fly    76 EDGTFPPQQVVDEWFEVLKDKYQQNPEACVAVHCVAGLGRAPVLVALALIELGLKYEAAVEMIRD 140
            :||..|..|:||:|..:|:.|:::.|..|:|||||||||||||||||||||.|:|||.||:.||.
Zfish    82 DDGAPPSNQIVDDWLNLLRVKFREEPGCCIAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQ 146

  Fly   141 KRRGAINAKQLSFLEKYKPKARLKHK--NGHKNSCSVQ 176
            |||||.|:|||.:||||:||.||:.|  |||:.:|.:|
Zfish   147 KRRGAFNSKQLFYLEKYRPKMRLRFKDSNGHRTNCCIQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRL-1NP_001260487.1 PTP-IVa 10..163 CDD:350350 88/151 (58%)
ptp4a1XP_021335279.1 PTPc 22..171 CDD:328744 86/148 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 137 1.000 Domainoid score I4844
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2587
Inparanoid 1 1.050 199 1.000 Inparanoid score I3757
OMA 1 1.010 - - QHG54094
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001421
OrthoInspector 1 1.000 - - otm24237
orthoMCL 1 0.900 - - OOG6_101823
Panther 1 1.100 - - O PTHR23339
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5007
SonicParanoid 1 1.000 - - X788
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.960

Return to query results.
Submit another query.