DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRL-1 and ptp4a1

DIOPT Version :9

Sequence 1:NP_001260487.1 Gene:PRL-1 / 34952 FlyBaseID:FBgn0024734 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001008023.1 Gene:ptp4a1 / 493385 XenbaseID:XB-GENE-973019 Length:173 Species:Xenopus tropicalis


Alignment Length:168 Identity:100/168 - (59%)
Similarity:127/168 - (75%) Gaps:2/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RPAPALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAF 75
            ||||..|.||.|:||||..|::.|:|.:|.||||..|.|:|||||.:|:|..:|.:||.|.|..|
 Frog     6 RPAPVEITYKNMRFLITHNPTNATLNKFIEELKKYGVTTLVRVCEATYDTALVEKEGIQVLDWPF 70

  Fly    76 EDGTFPPQQVVDEWFEVLKDKYQQNPEACVAVHCVAGLGRAPVLVALALIELGLKYEAAVEMIRD 140
            :||..|..|:||:|..:||.|:::.|..|:|||||||||||||||||||||.|:|||.||:.||.
 Frog    71 DDGAPPSNQIVDDWLNLLKMKFREEPGCCIAVHCVAGLGRAPVLVALALIESGMKYEDAVQFIRQ 135

  Fly   141 KRRGAINAKQLSFLEKYKPKARLKHK--NGHKNSCSVQ 176
            |||||.|:|||.:||||:||.||:.|  |||:|:|.:|
 Frog   136 KRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRL-1NP_001260487.1 PTP-IVa 10..163 CDD:350350 91/151 (60%)
ptp4a1NP_001008023.1 PTP-IVa1 1..167 CDD:350513 96/160 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4885
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2587
Inparanoid 1 1.050 203 1.000 Inparanoid score I3638
OMA 1 1.010 - - QHG54094
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001421
OrthoInspector 1 1.000 - - otm49162
Panther 1 1.100 - - O PTHR23339
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5007
SonicParanoid 1 1.000 - - X788
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.