DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRL-1 and ptp4a3a

DIOPT Version :9

Sequence 1:NP_001260487.1 Gene:PRL-1 / 34952 FlyBaseID:FBgn0024734 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_998346.1 Gene:ptp4a3a / 406460 ZFINID:ZDB-GENE-040426-2220 Length:173 Species:Danio rerio


Alignment Length:167 Identity:96/167 - (57%)
Similarity:126/167 - (75%) Gaps:2/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RPAPALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAF 75
            ||||..:.||.|:||||..|::.|::.:|.:|||..|.|||||||.:|:...||..||||.|..|
Zfish     6 RPAPVEVCYKNMRFLITHNPTNSTLSSFIEDLKKYGVTTVVRVCEITYDKTPLEKNGITVVDWPF 70

  Fly    76 EDGTFPPQQVVDEWFEVLKDKYQQNPEACVAVHCVAGLGRAPVLVALALIELGLKYEAAVEMIRD 140
            :||..||.:||::|..:||.::.:.|..||||||||||||||||||:||||.|:|||.|::.||.
Zfish    71 DDGAPPPSKVVEDWLSLLKRRFIEEPGCCVAVHCVAGLGRAPVLVAVALIESGMKYEDAIQFIRQ 135

  Fly   141 KRRGAINAKQLSFLEKYKPKARLKHKNGH--KNSCSV 175
            |||||||:|||::||||:||.||::|:.|  ||.|.:
Zfish   136 KRRGAINSKQLTYLEKYRPKQRLRYKHPHIFKNKCCI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRL-1NP_001260487.1 PTP-IVa 10..163 CDD:350350 89/151 (59%)
ptp4a3aNP_998346.1 PTPc 11..173 CDD:304379 92/162 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 137 1.000 Domainoid score I4844
eggNOG 1 0.900 - - E1_KOG2836
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 199 1.000 Inparanoid score I3757
OMA 1 1.010 - - QHG54094
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001421
OrthoInspector 1 1.000 - - otm24237
orthoMCL 1 0.900 - - OOG6_101823
Panther 1 1.100 - - LDO PTHR23339
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X788
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.