DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRL-1 and cdc14

DIOPT Version :9

Sequence 1:NP_001260487.1 Gene:PRL-1 / 34952 FlyBaseID:FBgn0024734 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001285721.1 Gene:cdc14 / 34067 FlyBaseID:FBgn0031952 Length:1052 Species:Drosophila melanogaster


Alignment Length:119 Identity:35/119 - (29%)
Similarity:56/119 - (47%) Gaps:6/119 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 YIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAFEDGTFPPQQVVDEWFEVLKDKYQQNPE 102
            |....:.|||.||:|:....|:....|..|...|||.|.||:.|...::.::..:.     :..:
  Fly   217 YFSYFRDNNVTTVIRLNAKVYHASSFENAGFDHKDLFFIDGSTPSDAIMKKFLSIC-----ETTK 276

  Fly   103 ACVAVHCVAGLGRAPVLV-ALALIELGLKYEAAVEMIRDKRRGAINAKQLSFLE 155
            ..:||||.|||||...|: |..:...|.....|:..:|..|.|::...|..::|
  Fly   277 GAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVIGHQQQWME 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRL-1NP_001260487.1 PTP-IVa 10..163 CDD:350350 35/119 (29%)
cdc14NP_001285721.1 DSPn 19..156 CDD:291343
PTPc 217..331 CDD:304379 35/119 (29%)
CDC14 <229..330 CDD:225297 29/105 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23339
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.