DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRL-1 and ptp4a2b

DIOPT Version :9

Sequence 1:NP_001260487.1 Gene:PRL-1 / 34952 FlyBaseID:FBgn0024734 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001257469.1 Gene:ptp4a2b / 334483 ZFINID:ZDB-GENE-041114-111 Length:174 Species:Danio rerio


Alignment Length:166 Identity:93/166 - (56%)
Similarity:122/166 - (73%) Gaps:0/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RPAPALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAF 75
            |||...|.|..|:||||..|::.|:|.:..||||..|||:|||||.:|:|..::.:||.|.|..|
Zfish     9 RPAAVEISYDCMRFLITHNPTNSTLNKFTEELKKFEVNTLVRVCEATYDTALVQKEGIQVFDWPF 73

  Fly    76 EDGTFPPQQVVDEWFEVLKDKYQQNPEACVAVHCVAGLGRAPVLVALALIELGLKYEAAVEMIRD 140
            :||..||.::||:|..:||.|:::.|..|:|||||||||||||||||||:|.|:|||.||..||.
Zfish    74 DDGASPPTRIVDDWLNLLKTKFREEPGCCIAVHCVAGLGRAPVLVALALLECGMKYEEAVMYIRQ 138

  Fly   141 KRRGAINAKQLSFLEKYKPKARLKHKNGHKNSCSVQ 176
            |||||.|||||.:||||:||.||:.|..:.::|.:|
Zfish   139 KRRGAFNAKQLMYLEKYRPKMRLRFKEANGHNCCIQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRL-1NP_001260487.1 PTP-IVa 10..163 CDD:350350 88/151 (58%)
ptp4a2bNP_001257469.1 PTPc 14..163 CDD:304379 87/148 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579994
Domainoid 1 1.000 137 1.000 Domainoid score I4844
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 199 1.000 Inparanoid score I3757
OMA 1 1.010 - - QHG54094
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001421
OrthoInspector 1 1.000 - - otm24237
orthoMCL 1 0.900 - - OOG6_101823
Panther 1 1.100 - - O PTHR23339
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X788
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.