DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRL-1 and PTP4A3

DIOPT Version :9

Sequence 1:NP_001260487.1 Gene:PRL-1 / 34952 FlyBaseID:FBgn0024734 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_116000.1 Gene:PTP4A3 / 11156 HGNCID:9636 Length:173 Species:Homo sapiens


Alignment Length:167 Identity:96/167 - (57%)
Similarity:124/167 - (74%) Gaps:2/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RPAPALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAF 75
            ||||..:.||.|:||||..|::.|::.:|.:|||....|||||||.:|:...||..||||.|..|
Human     6 RPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPF 70

  Fly    76 EDGTFPPQQVVDEWFEVLKDKYQQNPEACVAVHCVAGLGRAPVLVALALIELGLKYEAAVEMIRD 140
            :||..||.:||::|..::|.|:.:.|.:|||||||||||||||||||||||.|:|||.|::.||.
Human    71 DDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQ 135

  Fly   141 KRRGAINAKQLSFLEKYKPKARLKHK--NGHKNSCSV 175
            |||||||:|||::||||:||.||:.|  :.||..|.|
Human   136 KRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRL-1NP_001260487.1 PTP-IVa 10..163 CDD:350350 89/151 (59%)
PTP4A3NP_116000.1 PTP-IVa3 5..158 CDD:350511 89/151 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2836
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I3714
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54094
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001421
OrthoInspector 1 1.000 - - otm41940
orthoMCL 1 0.900 - - OOG6_101823
Panther 1 1.100 - - LDO PTHR23339
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X788
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.