DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRL-1 and ptp4a3

DIOPT Version :9

Sequence 1:NP_001260487.1 Gene:PRL-1 / 34952 FlyBaseID:FBgn0024734 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001135480.1 Gene:ptp4a3 / 100216017 XenbaseID:XB-GENE-943078 Length:173 Species:Xenopus tropicalis


Alignment Length:167 Identity:98/167 - (58%)
Similarity:125/167 - (74%) Gaps:2/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RPAPALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAF 75
            ||||..:.||.|:||||..|::.|:|.:|.:|||....|||||||.:|:...||..||||.|..|
 Frog     6 RPAPVEVCYKNMRFLITHNPTNATMNTFIEDLKKYGATTVVRVCEITYDKTPLEKDGITVMDWPF 70

  Fly    76 EDGTFPPQQVVDEWFEVLKDKYQQNPEACVAVHCVAGLGRAPVLVALALIELGLKYEAAVEMIRD 140
            :||..||.::||:|..:||.|:.::|..|||||||||||||||||||||||.|:|||.|::.||.
 Frog    71 DDGAPPPNKIVDDWLNLLKTKFCEDPGCCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQ 135

  Fly   141 KRRGAINAKQLSFLEKYKPKARLKHK--NGHKNSCSV 175
            |||||||:|||::||||:||.||:.|  :.|||.|.:
 Frog   136 KRRGAINSKQLTYLEKYRPKQRLRFKDPHNHKNKCCI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRL-1NP_001260487.1 PTP-IVa 10..163 CDD:350350 91/151 (60%)
ptp4a3NP_001135480.1 PTP-IVa3 5..158 CDD:350511 91/151 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4885
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 203 1.000 Inparanoid score I3638
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001421
OrthoInspector 1 1.000 - - otm49162
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X788
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.