DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ca-alpha1D and Catsper4

DIOPT Version :9

Sequence 1:NP_723952.2 Gene:Ca-alpha1D / 34950 FlyBaseID:FBgn0001991 Length:2705 Species:Drosophila melanogaster
Sequence 2:XP_342942.5 Gene:Catsper4 / 362623 RGDID:1565213 Length:448 Species:Rattus norvegicus


Alignment Length:380 Identity:84/380 - (22%)
Similarity:155/380 - (40%) Gaps:87/380 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   770 FEFLILLTIFANCIALAVYT-PYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGA 833
            |:.|:...:..|.|.:|:.| .|.|...   .:....::.:.|.|...|.::..|       ||.
  Rat    70 FQLLLAFLLVTNAITIALRTNSYLGQKH---YELFSTIDDIVLTILICEVLLGWL-------NGF 124

  Fly   834 YL--RNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILK 896
            ::  ::|||:|:|.||.|..:...:.|| .:.|....|||   ||.:.:...|..|..::..||:
  Rat   125 WIFWKDGWNILNFAIVFILFMGFFIKQL-NETFITYPLRA---LRLVHVCMAVEPLARIIRVILQ 185

  Fly   897 AMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPCGVGYQCPPGYKCYGG 961
            :|..|.::..|:||.::::::.|:.||...:.|                                
  Rat   186 SMPDLANVMALILFFMLVFSVFGVTLFGAFVPK-------------------------------- 218

  Fly   962 WDGPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQ--------DAMGSDWQWMYFISMVILG 1018
                     :|.|.|:|:.|:|.|:|.:||.|:....|        :..|:    :||...:.||
  Rat   219 ---------HFQNMGVALYTLFICITQDGWLDIYMDFQVEEREYAMEVGGA----IYFAIFITLG 270

  Fly  1019 AFFVMNLILGVLSGEFSKERNKAKNRGDFQKL--REKQQIEEDLRGYLDWI--------TQAEDI 1073
            ||..:||.:.|::....:.....:..|..|.:  .||...|||....|..:        |.|...
  Rat   271 AFIGLNLFVVVVTTNLEQMMKTGEEEGHLQPITFNEKDAEEEDWTDELPLVHCTEARKETSAVPQ 335

  Fly  1074 EPDAVGGLISDGKGKQPNEMDSTENLGEEMPEVQMTESRWRKMKKDFDRVNRRMR 1128
            || .|||.:.:...|      :.:|....:..:|.....:::::.:.:.:...:|
  Rat   336 EP-LVGGPLRNLSEK------TCDNFCLVLEAIQENLLEYKEIRDELNTIMEEVR 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ca-alpha1DNP_723952.2 Ion_trans 767..1042 CDD:395416 65/282 (23%)
Ion_trans 1137..1379 CDD:395416
Ion_trans 1496..1809 CDD:395416
Ion_trans 1851..2126 CDD:395416
GPHH 2135..2188 CDD:407139
Ca_chan_IQ 2199..2271 CDD:400901
Catsper4XP_342942.5 Ion_trans 91..289 CDD:278921 59/256 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.