DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ca-alpha1D and F17C8.6

DIOPT Version :9

Sequence 1:NP_723952.2 Gene:Ca-alpha1D / 34950 FlyBaseID:FBgn0001991 Length:2705 Species:Drosophila melanogaster
Sequence 2:NP_497974.1 Gene:F17C8.6 / 175626 WormBaseID:WBGene00008911 Length:279 Species:Caenorhabditis elegans


Alignment Length:249 Identity:50/249 - (20%)
Similarity:89/249 - (35%) Gaps:52/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  2115 MDNFD--YLTRDWSILGPHHLDEFIRLWSEYDPDAKGRIKHLDVVTLLRKI---------SPPLG 2168
            |:||.  |.:.:.::|....:..|..:|:..|.:.|..|....|..|||.:         |..|.
 Worm     1 MENFSLLYSSEEDALLSYADIRNFQLVWNMVDIEQKRSIPVRRVKFLLRLLKGRLEVNDESDGLL 65

  Fly  2169 FGKLCPHRMACKRLVSMNMPLNSDGTVLFNATLFAVVRTSLSIKTDGNIDD--ANSELRATI-KQ 2230
            |..:| |.|.         .|::...|.|:..|..:...|:.|:....:::  ...||...| ::
 Worm    66 FKHMC-HEME---------RLHNGDDVSFHDVLNMLSYRSVDIRKSLQLEELLQREELEYIIEEE 120

  Fly  2231 IWKRTNPKLLDQVVPPPGNDDEVTVGKF------YATYLIQDYFRR----FKKRKEQEGKEGHPD 2285
            :.|.|....|:..:.........|:||.      :|....|:...:    .:...|::..:|...
 Worm   121 VAKHTIRAWLENCLKNIKAKQNNTLGKMSSIGSTFAFPQSQEVLTKGVVLTEASPEEDSLQGDKG 185

  Fly  2286 SNTVTLQAGLRTLHEVSPALKRAIS------------------GNLDELDQEPE 2321
            |.....|.|......|:.|.|:::.                  |..|||::..|
 Worm   186 SGKKKAQRGNSITEIVAEAQKKSVKRATDKISERRGTLRQMQMGTYDELEEVEE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ca-alpha1DNP_723952.2 Ion_trans 767..1042 CDD:395416
Ion_trans 1137..1379 CDD:395416
Ion_trans 1496..1809 CDD:395416
Ion_trans 1851..2126 CDD:395416 4/12 (33%)
GPHH 2135..2188 CDD:407139 15/61 (25%)
Ca_chan_IQ 2199..2271 CDD:400901 14/84 (17%)
F17C8.6NP_497974.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D172471at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.