DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4892 and LOC499235

DIOPT Version :9

Sequence 1:NP_609778.3 Gene:CG4892 / 34949 FlyBaseID:FBgn0028884 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_574528.1 Gene:LOC499235 / 499235 RGDID:1565730 Length:159 Species:Rattus norvegicus


Alignment Length:123 Identity:31/123 - (25%)
Similarity:43/123 - (34%) Gaps:24/123 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DVKAQDSEQTDTGGDGMNVGQKHDDDIGNTTCPWVKMEHALEQQKLKEPMSVEQPNKKEPSEVKS 180
            |..|.|::.|.......|:..........::.||.|.  ||.|   ..|..|......||: :.|
  Rat     8 DPSAHDNQYTKYTEQRKNIKNLQGSGAEKSSGPWNKT--ALVQ---APPAPVTVTETPEPA-MPS 66

  Fly   181 QIYIPPALRQSQGDFNRRDQAESRLRKVPSKMSGKPQAPDLNSDEYFPSLSKALKRTK 238
            .:|.||..|.            :..||.|.      ..|::.||..||||....|..:
  Rat    67 GVYRPPGARL------------TTTRKTPQ------GPPEIYSDTQFPSLQSTAKHVE 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4892NP_609778.3 CDV3 82..233 CDD:405941 30/116 (26%)
LOC499235XP_574528.1 CDV3 <30..101 CDD:292003 25/94 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005872
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16284
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.